Recombinant Bacillus subtilis Sensor histidine kinase yvfT (yvfT)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Bacillus subtilis

yvfT operates as the histidine kinase of the YvfT/YvfU TCS, regulating downstream genes in response to environmental cues. Key findings include:

Regulatory Targets

  • Primary Target: The yvfRS operon, encoding an ABC transporter involved in membrane homeostasis .

  • Cross-Regulation: DesK/DesR TCS modulates yvfRS expression, with DesR binding to its promoter in its unphosphorylated state .

  • Temperature-Dependent Regulation:

    • yvfRS transcription is induced at 37°C (unlike des, which is active at lower temperatures) .

    • DesR and YvfU compete for promoter binding, enabling fine-tuned gene expression .

Production and Purification

  • Expression System: E. coli with His-tag for nickel affinity chromatography .

  • Purity and Stability:

    • ≥90% purity (SDS-PAGE) .

    • Lyophilized powder stored at -20°C/-80°C .

  • Reconstitution: Recommended in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

Research Applications

  1. Study of TCS Cross-Regulation:

    • YvfT/YvfU and DesK/DesR interactions are critical for membrane lipid homeostasis and stress responses .

    • In vitro binding assays confirm YvfU and DesR compete for promoter regions .

  2. Biochemical Characterization:

    • Autokinase activity and phosphotransfer to YvfU .

    • Structural studies of transmembrane domains and linker motifs .

Gene Expression Dynamics

  • Operon Transcription:

    • yvfTU is co-transcribed with BC5355/BC5354 under specific growth conditions (e.g., stationary phase) .

    • Basal expression in exponential phase, with increased activity post-stationary phase .

  • Regulatory Complexity:

    • YvfT/YvfU modulates a subset of the PlcR regulon, including toxins and degradative enzymes .

    • plcR mRNA levels are reduced in ΔyvfTU mutants, indicating YvfT/YvfU’s role in virulence regulation .

Comparative Analysis with DesK/DesR

ParameterYvfT/YvfUDesK/DesR
Primary FunctionABC transporter regulationMembrane lipid desaturation
Temperature ResponseActivated at 37°CActivated at lower temperatures
Regulatory PartnerDesR (unphosphorylated)DesR (phosphorylated)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yvfT; BSU34070; Sensor histidine kinase YvfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yvfT
Target Protein Sequence
MKKAISIFPKEFGFFPYIFLVYTIMPFLSLLKESGVKQGIGYGMLLLFVAAYRQLFCSVG KASFTYWLIVQMAVILMYSVFYNITYIYLGFFPANFVGYYKEKTNFNRAFCALIFILLFP CLYQFIANSVSLRELFSVLPFLVIMLISPFGIRSMFRRIELEAKLAQANEQIKELSKREE RVRIARDLHDTLGHTLSLLTLKSQLIQRLAASDPERTKLEAKEMETSSRSALKQVRELVS DMRTVTITEELVNIQHILRAGNITFQYEGADDFSVISPVTQNIISMCMREAVTNIIKHSK ATHCAITISQFADKMRIVIRDDGKGAPKEKMFGNGLWGMEERLMLIEGGLTVSDHNGTVV ALTIPLIKKAE
Uniprot No.

Target Background

Function
A member of the two-component regulatory system YvfT/YvfU. It likely activates YvfU through phosphorylation.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the YvfT/YvfU two-component system in Bacillus subtilis?

The YvfT/YvfU system represents a paralogous two-component signal transduction system (TCS) in Bacillus subtilis. YvfT functions as a sensor histidine kinase with membrane-spanning domains and a cytoplasmic histidine phosphotransferase domain, while YvfU serves as its cognate response regulator. Recent research has demonstrated that this TCS controls the expression of the yvfRS operon, which encodes an ABC transporter involved in bacterial adaptability to environmental conditions . The YvfT sensor kinase specifically belongs to a subgroup of membrane kinases with short cytoplasmic linkers (≤40 amino acids) that connect the transmembrane sensing domain to the histidine phosphotransferase domain .

How does the YvfT/YvfU system differ from other two-component systems in B. subtilis?

The YvfT/YvfU system is among the 36 histidine kinases and 34 response regulators identified in the B. subtilis genome . What distinguishes YvfT/YvfU is its participation in cross-regulation with another TCS, DesK/DesR, which is primarily responsible for membrane lipid homeostasis . Unlike some other B. subtilis kinases, YvfT belongs to a specific structural subgroup along with YocF and YdfH, characterized by short cytoplasmic linkers between the membrane-spanning and phosphotransferase domains . Additionally, unlike the composite kinases found in E. coli, YvfT does not contain a contiguous phosphorylatable response regulator domain within the same polypeptide .

What is the function of the YvfT/YvfU system in Bacillus subtilis?

The YvfT/YvfU system primarily controls the expression of the yvfRS operon, which encodes components of an ABC transporter . Interestingly, this regulation exhibits temperature dependence, with yvfRS transcription being induced at 37°C but not at 25°C, suggesting a role in temperature adaptation . This contrasts with the DesK/DesR system, which regulates des gene transcription in the opposite temperature pattern (active at 25°C, not at 37°C). The YvfT/YvfU system thus appears to function in environmental adaptation mechanisms, particularly in response to temperature fluctuations, contributing to B. subtilis' remarkable ability to survive and thrive across various ecological niches .

What structural features characterize the YvfT sensor histidine kinase?

YvfT possesses a domain architecture typical of membrane-bound histidine kinases, with:

  • Membrane-spanning sensor domains that recognize environmental signals

  • A short cytoplasmic linker (≤40 amino acids) connecting the sensor domain to the catalytic domain

  • A conserved histidine phosphotransferase domain containing the phosphorylatable histidine residue

  • An ATP-binding domain characteristic of sensor histidine kinases

YvfT's cytoplasmic linker places it in a structural subgroup with YocF and YdfH . Unlike kinases with longer linkers, YvfT does not contain the conserved sequence motifs (such as DEIGXhyA or GhyhyAhyhyXDXTE) found in kinases with intermediate or longer linkers . This structural organization likely influences its signal perception and transduction mechanism.

What are the most effective methods for creating recombinant YvfT constructs in B. subtilis?

Creating recombinant YvfT constructs requires careful design considering the membrane-embedded nature of this protein. A methodological approach includes:

  • Gene amplification and cloning strategy:

    • PCR amplification of the yvfT gene from B. subtilis genomic DNA

    • Introduction of appropriate restriction sites for directional cloning

    • Incorporation of affinity or fluorescent tags (preferably C-terminal to avoid interfering with membrane topology)

  • Expression vector selection:

    • Use of B. subtilis-compatible vectors with inducible promoters (e.g., IPTG-inducible Pspac)

    • Integration vectors for chromosomal insertion to maintain physiological expression levels

    • Shuttle vectors for expression in both E. coli (cloning) and B. subtilis (functional studies)

  • Transformation approaches:

    • Natural competence protocols for chromosomal integration

    • Protoplast transformation for plasmid delivery, which yields recombination efficiency of approximately 19.3% of heterozygotic cells

    • Electroporation for plasmid transformation

  • Verification strategies:

    • Sequencing verification of constructs

    • Western blotting for protein expression

    • Functional complementation of yvfT knockout strains

When designing recombinant YvfT constructs, researchers should carefully consider the preservation of membrane topology and the potential impact of fusion tags on signaling function.

How can I design experiments to study the cross-regulation between YvfT/YvfU and DesK/DesR systems?

Studying cross-regulation between these two TCSs requires a systematic experimental approach:

Experimental design strategy:

  • Genetic manipulation approach:

    • Create single and double knockout strains (ΔyvfT, ΔyvfU, ΔdesK, ΔdesR, ΔyvfT/ΔdesK, ΔyvfU/ΔdesR)

    • Generate complementation strains with wild-type and mutated versions of each component

    • Develop reporter systems for both target operons (yvfRS and des)

  • Temperature-responsive expression analysis:

    • Culture cells at various temperatures (25°C, 30°C, 37°C, 42°C)

    • Measure target gene expression using:

      • qRT-PCR for transcript levels

      • Reporter fusions (e.g., lacZ, luciferase, fluorescent proteins)

      • Proteomics for protein abundance

  • In vitro molecular studies:

    • Purify recombinant histidine kinases and response regulators

    • Perform cross-phosphorylation assays between non-cognate pairs

    • Conduct DNA binding studies with both phosphorylated and unphosphorylated regulators

    • Utilize surface plasmon resonance or isothermal titration calorimetry to quantify binding affinities

  • Promoter-binding characterization:

    • Perform DNase I footprinting to identify binding sites

    • Use electrophoretic mobility shift assays to assess binding of both regulators to both promoters

    • Implement chromatin immunoprecipitation to validate in vivo binding

Experimental ConditionyvfRS Expressiondes ExpressionExpected Regulatory Mechanism
25°C, Wild-typeLowHighDesK/DesR active, YvfT/YvfU inactive
37°C, Wild-typeHighLowYvfT/YvfU active, DesK/DesR inactive
25°C, ΔdesKLowLowLoss of des activation
37°C, ΔyvfTLowLowLoss of yvfRS activation
25°C, ΔdesRVariableLowPotential derepression of yvfRS
37°C, ΔyvfULowVariablePotential effect on des regulation

This comprehensive approach allows for dissection of the complex interplay between these two temperature-responsive TCSs .

What approaches can be used to investigate the temperature-sensing mechanism of the YvfT histidine kinase?

Investigating the temperature-sensing mechanism of YvfT requires multiple complementary approaches:

  • Domain mapping and mutagenesis:

    • Create chimeric proteins between YvfT and DesK or other histidine kinases

    • Perform systematic site-directed mutagenesis of transmembrane domains

    • Generate truncated versions to identify minimal sensing regions

    • Introduce point mutations at conserved residues in the cytoplasmic linker

  • Membrane composition studies:

    • Manipulate membrane fluidity using fatty acid supplements

    • Measure YvfT activity in B. subtilis strains with altered membrane composition

    • Reconstitute purified YvfT in liposomes with defined lipid compositions

    • Monitor thermally induced conformational changes using circular dichroism

  • Structural biology approaches:

    • Cryo-electron microscopy of the membrane-embedded kinase

    • Nuclear magnetic resonance of sensor domains in membrane mimetics

    • X-ray crystallography of soluble domains

    • Molecular dynamics simulations of temperature effects on protein conformation

  • In vivo activation studies:

    • Implement FRET-based sensors to monitor conformational changes in real-time

    • Develop phosphorylation-specific antibodies to track activation kinetics

    • Use crosslinking approaches to capture temperature-dependent interaction partners

    • Employ proteomics to identify novel interacting proteins at different temperatures

These methodological approaches should be used in combination to develop a comprehensive model of YvfT's temperature-sensing mechanism .

How does signal transduction occur in the YvfT/YvfU two-component system?

Signal transduction in the YvfT/YvfU system follows a canonical two-component system mechanism with some unique features:

  • Signal sensing:

    • The membrane-embedded sensor domain of YvfT detects environmental signals (primarily temperature elevation to 37°C)

    • This recognition likely involves conformational changes in the transmembrane helices

  • Autophosphorylation:

    • Signal detection triggers ATP binding and autophosphorylation of a conserved histidine residue in YvfT's phosphotransferase domain

    • The autophosphorylation reaction involves: YvfT-His + ATP → YvfT-His~P + ADP

  • Phosphotransfer:

    • The phosphoryl group is transferred from YvfT-His~P to a conserved aspartate residue in YvfU

    • YvfT-His~P + YvfU-Asp → YvfT-His + YvfU-Asp~P

  • Transcriptional regulation:

    • Phosphorylated YvfU undergoes conformational changes that alter its DNA-binding properties

    • YvfU~P binds to the promoter region of the yvfRS operon, activating transcription

    • Interestingly, unphosphorylated DesR also binds to this promoter region, suggesting complex regulatory interactions

The signal transduction pathway is subject to cross-regulation by the DesK/DesR system, with both systems responding to temperature changes but in opposite directions . This suggests that these systems may have evolved to ensure precise control of gene expression across temperature ranges experienced by B. subtilis in its natural environment.

What methods are recommended for measuring YvfT phosphorylation activity in vitro?

Measuring YvfT phosphorylation activity in vitro requires careful protein preparation and sensitive detection methods:

  • Protein preparation:

    • Express and purify the cytoplasmic domain of YvfT fused to a solubility tag (MBP, SUMO)

    • Use detergent solubilization for full-length YvfT (recommended detergents: DDM, LDAO)

    • Reconstitute purified full-length YvfT in nanodiscs or liposomes to maintain native conformation

    • Purify the YvfU response regulator under native conditions

  • Autophosphorylation assays:

    • Incubate purified YvfT with [γ-³²P]ATP at different temperatures (25°C, 30°C, 37°C, 42°C)

    • Separate proteins by SDS-PAGE and detect phosphorylation by autoradiography

    • As an alternative to radioactivity, use Phos-tag™ acrylamide gels for mobility shift detection

    • Implement mass spectrometry to identify the specific phosphorylated residues

  • Phosphotransfer assays:

    • Perform a two-step reaction: first autophosphorylate YvfT, then add YvfU

    • Monitor phosphotransfer kinetics with time-course sampling

    • Test cross-phosphorylation with non-cognate response regulators (especially DesR)

    • Use phosphoprotein staining or antibody detection as alternatives to radioisotopes

  • Temperature-dependent activity profiling:

    • Plot phosphorylation activity versus temperature to determine optimal temperature range

    • Measure activation energy using Arrhenius plots

    • Compare thermal profiles with those of DesK to highlight differences

Temperature (°C)Expected YvfT ActivityExpected DesK ActivityMethod of Detection
25LowHighAutoradiography or Phos-tag™
30IntermediateIntermediateAutoradiography or Phos-tag™
37HighLowAutoradiography or Phos-tag™
42VariableVery lowAutoradiography or Phos-tag™

These in vitro assays provide crucial biochemical evidence for the temperature-dependent activity of YvfT observed in vivo .

How can I design experiments to characterize the binding sites of YvfU and DesR on the yvfRS promoter?

Characterizing the binding sites of these response regulators requires a systematic approach:

  • Promoter mapping and in silico analysis:

    • Identify the yvfRS transcription start site using 5' RACE

    • Perform bioinformatic analysis to identify potential binding motifs

    • Compare with known DesR binding sites on the des promoter

    • Generate a series of promoter fragments for binding studies

  • In vitro DNA binding assays:

    • Electrophoretic Mobility Shift Assays (EMSA):

      • Incubate labeled promoter fragments with purified YvfU (both phosphorylated and unphosphorylated)

      • Test competition with unlabeled specific and non-specific DNA

      • Perform supershift assays with anti-YvfU antibodies

      • Repeat with DesR to identify shared or distinct binding regions

    • DNase I Footprinting:

      • Use labeled promoter DNA and titrate with purified regulators

      • Identify protected regions through comparison with sequencing ladders

      • Compare footprints of YvfU~P, YvfU, DesR~P, and DesR

    • DNA Affinity Precipitation:

      • Immobilize promoter fragments on magnetic beads

      • Pull down proteins from B. subtilis lysates grown at different temperatures

      • Identify bound proteins by mass spectrometry

  • Mutational analysis:

    • Create point mutations in predicted binding sites

    • Test mutant promoters in vitro (EMSA, footprinting) and in vivo (reporter assays)

    • Generate a consensus binding sequence for each regulator

  • In vivo binding confirmation:

    • Perform chromatin immunoprecipitation (ChIP) with antibodies against YvfU and DesR

    • Implement ChIP-seq to identify all genomic binding sites

    • Use DNA adenine methyltransferase identification (DamID) as an alternative approach

These complementary techniques will provide a comprehensive map of regulator binding sites and their overlaps, helping to understand the molecular basis of cross-regulation .

What strategies can be employed to study the temperature-dependent expression of the yvfRS operon?

Investigating temperature-dependent expression requires a multi-faceted approach:

  • Reporter system construction:

    • Generate transcriptional fusions of the yvfRS promoter with reporter genes:

      • β-galactosidase (lacZ) for quantitative enzymatic assays

      • Luciferase for real-time monitoring

      • Fluorescent proteins (GFP, mCherry) for single-cell analysis

    • Integrate reporters at neutral genomic loci to maintain native promoter context

  • Temperature shift experiments:

    • Cultivate B. subtilis strains at different temperatures (25°C, 30°C, 37°C, 42°C)

    • Perform temperature upshift/downshift experiments with time-course sampling

    • Measure reporter activity at each timepoint to generate expression kinetics

    • Compare wild-type with relevant mutants (ΔyvfT, ΔyvfU, ΔdesK, ΔdesR)

  • Transcript analysis:

    • Quantify yvfRS mRNA levels using qRT-PCR

    • Perform RNA-seq to identify the complete temperature-regulated transcriptome

    • Use Northern blotting to determine transcript size and stability

    • Implement transcription start site mapping to identify alternative promoters

  • Single-cell expression studies:

    • Use microfluidic devices with temperature control for live-cell imaging

    • Perform flow cytometry with fluorescent reporters to quantify population heterogeneity

    • Implement single-cell RNA-FISH to visualize transcript localization

Experimental SystemAdvantagesLimitationsRecommended Analysis
lacZ fusionQuantitative, established protocolsEndpoint measurementMiller assays at multiple temperatures
Luciferase fusionReal-time, high sensitivitySubstrate addition requiredContinuous monitoring during temperature shifts
Fluorescent protein fusionSingle-cell resolution, no substrate neededMaturation time, photobleachingFlow cytometry, time-lapse microscopy
qRT-PCRDirect measurement of transcriptsRNA isolation requirementsRelative expression compared to housekeeping genes
RNA-seqGenome-wide analysisCost, complex data analysisDifferential expression analysis between temperatures

This comprehensive approach will provide insights into the kinetics, magnitude, and cell-to-cell variability of temperature-dependent gene expression .

What are the most effective methods for creating yvfT knockout strains in B. subtilis?

Creating precise yvfT knockout strains requires careful consideration of B. subtilis genetic manipulation techniques:

  • Design considerations:

    • Complete gene deletion versus disruption (insertion)

    • Marker selection (antibiotic resistance, auxotrophy complementation)

    • Potential polar effects on downstream genes (especially yvfU)

    • Strategy for marker removal if needed (Cre-lox, FLP-FRT)

  • Long-flanking homology PCR method:

    • Amplify ~1 kb upstream and downstream regions of yvfT

    • Fuse these fragments with a selectable marker cassette

    • Transform into naturally competent B. subtilis

    • Select transformants on appropriate media

    • Verify integration by PCR and sequencing

  • pMUTIN-based integration:

    • Clone an internal fragment of yvfT into a pMUTIN vector

    • Single-crossover integration disrupts the gene

    • Provides transcriptional control of downstream genes

    • Enables lacZ reporter fusion to monitor native expression

  • CRISPR-Cas9 approach:

    • Design sgRNA targeting yvfT

    • Provide repair template with homology arms

    • Transform CRISPR components with repair template

    • Screen for markerless deletions

    • Verify by sequencing

  • Verification strategies:

    • PCR verification across junctions

    • Whole-genome sequencing to confirm clean deletion

    • RT-PCR to confirm absence of transcript

    • Western blotting if antibodies are available

    • Phenotypic characterization (growth at 37°C, yvfRS expression)

A comprehensive knockout strategy should include constructing both single (ΔyvfT) and double mutants (ΔyvfT/ΔdesK) to study the individual and combined effects of these sensor kinases .

How can I design experiments to study the phenotypic effects of yvfT mutations on B. subtilis physiology?

Investigating phenotypic effects of yvfT mutations requires a systematic approach:

  • Growth and morphological characterization:

    • Measure growth curves at different temperatures (25°C, 30°C, 37°C, 42°C)

    • Conduct microscopic analysis (phase contrast, fluorescence with membrane stains)

    • Implement electron microscopy to examine ultrastructural features

    • Quantify cell dimensions, chain formation, and morphological abnormalities

  • Stress resistance profiling:

    • Test survival under various stresses (temperature shifts, osmotic stress, pH)

    • Perform competitive fitness assays with wild-type strain

    • Measure biofilm formation capacity

    • Assess sporulation efficiency and germination rates

  • Membrane composition analysis:

    • Analyze fatty acid profiles using gas chromatography-mass spectrometry

    • Measure membrane fluidity using fluorescence anisotropy

    • Investigate lipid domain organization with fluorescent lipid probes

    • Determine phospholipid composition changes at different temperatures

  • Transcriptomic and proteomic studies:

    • Perform RNA-seq comparing wild-type and ΔyvfT strains at different temperatures

    • Implement quantitative proteomics to identify protein-level changes

    • Use ChIP-seq to map YvfU binding sites genome-wide

    • Analyze metabolomics profiles to identify pathway alterations

  • ABC transporter functionality:

    • Measure uptake or export of potential YvfRS substrates

    • Determine substrate specificity using radioactively labeled compounds

    • Assess the impact of yvfT deletion on transport kinetics

    • Test chemical sensitivity profiles to identify potential transport functions

Phenotypic AssayWild-type Expected ResultΔyvfT Expected ResultRelevance to YvfT Function
Growth at 37°CNormal growthPotentially reducedTemperature adaptation
yvfRS expressionHigh at 37°CLow at all temperaturesDirect regulatory role
Membrane fluidityMaintained across temperaturesPotentially alteredIndirect effects via ABC transporter
Stress survivalNormal resistancePotentially compromisedPhysiological role in adaptation
Transport assaysActive transportReduced transportFunctional consequence of reduced yvfRS

These experiments will provide comprehensive insights into YvfT's role in B. subtilis physiology beyond just gene regulation .

What experimental approaches can elucidate the molecular mechanism of cross-regulation between YvfT/YvfU and DesK/DesR systems?

Investigating cross-regulation mechanisms requires sophisticated experimental strategies:

  • Phosphorylation crosstalk analysis:

    • In vitro phosphotransfer assays:

      • Test all possible combinations: YvfT→YvfU, YvfT→DesR, DesK→DesR, DesK→YvfU

      • Use purified proteins and radioactive ATP to track phosphoryl transfer

      • Quantify kinetics and efficiency of cognate versus non-cognate phosphorylation

    • Phosphatase activity measurement:

      • Determine if YvfT can dephosphorylate DesR~P and vice versa

      • Compare cognate versus non-cognate dephosphorylation rates

      • Identify conditions that modulate phosphatase versus kinase activities

  • Protein-protein interaction studies:

    • Bacterial two-hybrid assays:

      • Test direct interactions between all components (YvfT-YvfU, YvfT-DesR, etc.)

      • Include domain truncations to map interaction regions

    • Co-immunoprecipitation:

      • Use tagged versions of the proteins expressed at native levels

      • Determine if these TCSs form higher-order complexes in vivo

    • FRET-based approaches:

      • Create fluorescent protein fusions for dynamic interaction studies

      • Monitor interactions in response to temperature shifts in real-time

  • DNA binding competition studies:

    • Sequential EMSA:

      • Pre-incubate promoter DNA with one regulator, then add the second

      • Determine if binding is competitive, cooperative, or independent

    • DNase I footprinting with both regulators:

      • Identify regions of overlapping or distinct protection

      • Determine if simultaneous binding occurs at different concentrations

    • DNA structure analysis:

      • Investigate if regulator binding induces DNA bending or other conformational changes

      • Determine if one regulator alters DNA structure to influence binding of the other

  • Systems biology approaches:

    • Mathematical modeling:

      • Develop kinetic models of the interconnected TCSs

      • Simulate temperature-dependent behaviors and cross-regulation

      • Predict system behavior under various conditions

    • Global regulatory network analysis:

      • Perform RNA-seq on single and double mutants

      • Identify genes affected by both systems

      • Construct regulatory networks to visualize cross-regulation effects

These complementary approaches will elucidate the molecular mechanisms underlying the observed cross-regulation between these TCSs .

How can I design experiments to identify additional genes regulated by the YvfT/YvfU system beyond the yvfRS operon?

Identifying the complete YvfT/YvfU regulon requires genome-wide approaches:

  • Transcriptome profiling:

    • RNA-seq analysis:

      • Compare wild-type, ΔyvfT, ΔyvfU, and constitutively active YvfU strains

      • Analyze at multiple temperatures (25°C, 37°C) and growth phases

      • Identify genes with expression patterns similar to yvfRS

      • Perform differential expression analysis to identify direct and indirect effects

    • Microarray analysis:

      • Alternative to RNA-seq, using genome-wide arrays

      • Identify co-regulated genes across conditions

      • Validate key findings with qRT-PCR

  • Chromatin immunoprecipitation approaches:

    • ChIP-seq with YvfU:

      • Use epitope-tagged YvfU expressed at native levels

      • Perform ChIP-seq at 37°C when the system is most active

      • Compare binding profiles of phosphorylated and unphosphorylated YvfU

      • Identify genome-wide binding sites beyond the yvfRS promoter

    • ChIP-exo or CUT&RUN:

      • Higher-resolution alternatives to standard ChIP-seq

      • More precisely define binding motifs and locations

  • Bioinformatic prediction and validation:

    • Derive a consensus YvfU binding motif from known sites

    • Perform genome-wide searches for similar sequences

    • Test candidate promoters with reporter fusions

    • Validate direct binding with in vitro assays (EMSA, footprinting)

  • Proteomics approaches:

    • Quantitative proteomics comparing wild-type and mutant strains

    • Phosphoproteomics to identify proteins with altered phosphorylation states

    • Membrane proteomics to identify changes in membrane protein composition

    • Secretome analysis to identify differentially secreted proteins

Experimental ApproachAdvantagesLimitationsExpected Outcomes
RNA-seqComprehensive, quantitativeIndirect effects includedComplete transcriptome changes
ChIP-seqDirect binding sitesRequires antibody or tagGenome-wide binding profile
Motif analysisRapid, computationalFalse positivesPredicted regulon members
ProteomicsProtein-level confirmationTechnical challenges with membrane proteinsFunctional consequences of regulation

The integration of these complementary approaches will provide a comprehensive map of the YvfT/YvfU regulon and its overlap with other regulatory networks, including DesK/DesR .

How can recombinant YvfT be utilized in synthetic biology applications for temperature-responsive gene expression systems?

Recombinant YvfT offers significant potential for engineering temperature-responsive systems:

  • Modular temperature-sensing components:

    • Extract the YvfT sensor domain for fusion to alternative output domains

    • Create chimeric proteins combining YvfT's temperature sensing with different effector functions

    • Develop synthetic TCSs with orthogonal signaling to natural systems

    • Construct libraries of YvfT variants with altered temperature thresholds

  • Synthetic genetic circuits:

    • Temperature-controlled switches:

      • Engineer promoters containing YvfU binding sites upstream of desired genes

      • Create systems where gene expression is specifically activated at 37°C

      • Develop antagonistic circuits combining YvfT and DesK sensing for bidirectional control

    • Temperature-responsive CRISPR systems:

      • Control Cas9 or dCas9 expression using YvfT/YvfU regulation

      • Enable temperature-dependent genome editing or gene regulation

      • Implement logic gates combining temperature and other environmental inputs

  • Engineered B. subtilis chassis cells:

    • Modify YvfT/YvfU to control expression of industrial enzymes or bioproducts

    • Create temperature-inducible production strains that activate at optimal temperatures

    • Engineer cells with extended chronological lifespan by modifying autolysis genes under temperature control

    • Develop biosensor strains that report temperature fluctuations through reporter gene expression

  • Experimental design considerations:

    • Characterize natural YvfT temperature response range (typically 25-42°C)

    • Implement directed evolution to expand sensing range

    • Test system performance in various growth media and conditions

    • Optimize expression levels of recombinant components to avoid overloading cellular resources

The application of recombinant YvfT in synthetic biology could enable precise temperature-dependent control of gene expression for biotechnology applications, with the advantage of using a naturally evolved sensor adapted to physiologically relevant temperatures .

What methodological approaches are recommended for studying the structural basis of YvfT temperature sensing?

Understanding the structural basis of YvfT temperature sensing requires advanced structural biology approaches:

  • Protein domain analysis and construct design:

    • Generate series of YvfT constructs (full-length, transmembrane domains, cytoplasmic domains)

    • Express domains separately for structural studies

    • Create fusion proteins with solubility-enhancing tags

    • Design mutations targeting potential temperature-sensing residues

  • Membrane protein structural studies:

    • Cryo-electron microscopy:

      • Reconstitute YvfT in nanodiscs or liposomes

      • Collect images at different temperatures

      • Generate 3D reconstructions of different conformational states

      • Compare structures at 25°C versus 37°C

    • X-ray crystallography:

      • Focus on soluble domains (cytoplasmic portion)

      • Use lipidic cubic phase for crystallization of transmembrane regions

      • Attempt co-crystallization with stabilizing antibodies or nanobodies

    • NMR spectroscopy:

      • Use isotope-labeled domains for solution NMR

      • Implement solid-state NMR for membrane-embedded regions

      • Perform temperature titration to identify shifting residues

  • Dynamics and conformational change studies:

    • Hydrogen-deuterium exchange mass spectrometry:

      • Compare exchange patterns at different temperatures

      • Identify regions with temperature-dependent accessibility

      • Map conformational changes to specific domains

    • FRET-based approaches:

      • Introduce fluorophore pairs at strategic positions

      • Monitor distance changes upon temperature shifts

      • Develop real-time sensors of conformational changes

    • Molecular dynamics simulations:

      • Build models based on experimental structures

      • Simulate behavior at different temperatures

      • Identify key residues and interactions that respond to temperature

  • Functional validation:

    • Create point mutations in predicted sensing residues

    • Assess temperature response in vivo using reporter systems

    • Measure thermodynamic parameters of mutants using microcalorimetry

    • Correlate structural features with functional outcomes

The integrated application of these structural biology approaches will provide mechanistic insights into how YvfT senses and responds to temperature changes at the molecular level .

What are the key remaining questions in the field of YvfT/YvfU research and how might they be addressed?

Despite recent advances, several fundamental questions remain in YvfT/YvfU research:

  • Molecular basis of temperature sensing:

    • How does YvfT specifically detect temperature changes?

    • What conformational changes occur upon temperature shift?

    • How is the signal transmitted from sensor domain to kinase domain?

    Potential approaches: Combine structural studies with molecular dynamics simulations; perform systematic mutagenesis of transmembrane regions; develop in vivo FRET sensors to detect conformational changes.

  • Physiological role of the YvfRS ABC transporter:

    • What substrates are transported by YvfRS?

    • How does this transport function contribute to temperature adaptation?

    • What is the connection between membrane homeostasis and transport?

    Potential approaches: Perform substrate screening using radioactive tracers; conduct metabolomics analysis of ΔyvfRS strains; implement transport assays in membrane vesicles or reconstituted systems.

  • Evolutionary significance of cross-regulation:

    • Why did B. subtilis evolve two temperature-responsive TCSs with opposite behaviors?

    • What selective advantage does this regulatory architecture provide?

    • Are there additional layers of cross-regulation with other TCSs?

    Potential approaches: Perform comparative genomics across Bacillus species; implement experimental evolution under fluctuating temperature conditions; construct synthetic systems with alternative regulatory architectures.

  • Global regulatory networks:

    • Beyond yvfRS, what other genes are regulated by YvfT/YvfU?

    • How does YvfT/YvfU signaling integrate with other stress response systems?

    • What is the hierarchy of response in complex environmental conditions?

    Potential approaches: Implement systems biology approaches combining transcriptomics, proteomics, and ChIP-seq; perform network analysis to identify regulatory hubs; study responses to combined stresses.

Addressing these questions will require interdisciplinary approaches combining molecular genetics, biochemistry, structural biology, and systems biology .

How can I design a comprehensive research project to investigate the YvfT/YvfU and DesK/DesR cross-regulation in B. subtilis?

A comprehensive research project investigating this cross-regulation system should include:

  • Project framework and timeline:

    Phase 1: Molecular characterization (Months 1-6)

    • Generate knockout strains (ΔyvfT, ΔyvfU, ΔdesK, ΔdesR, combinations)

    • Construct reporter systems for both target operons

    • Establish expression and purification of recombinant proteins

    • Perform initial phosphorylation and DNA binding assays

    Phase 2: Regulatory mechanism investigation (Months 7-12)

    • Map binding sites for both regulators on both promoters

    • Characterize temperature-dependent expression profiles

    • Study cross-phosphorylation between non-cognate pairs

    • Identify additional genes in the regulons

    Phase 3: Structural and functional studies (Months 13-24)

    • Determine structures of key domains

    • Identify temperature-sensing mechanisms

    • Characterize the YvfRS transport function

    • Develop synthetic biology applications

  • Experimental design considerations:

    • Include appropriate controls for all experiments

    • Implement biological and technical replicates

    • Use complementary techniques to validate key findings

    • Consider both in vitro biochemical and in vivo physiological approaches

  • Expected outcomes and potential challenges:

    Expected outcomes:

    • Comprehensive model of temperature-dependent cross-regulation

    • Structural basis for temperature sensing by YvfT

    • Functional characterization of YvfRS transporter

    • Identification of complete regulons for both TCSs

    Potential challenges:

    • Membrane protein expression and purification difficulties

    • Separating direct from indirect regulatory effects

    • Establishing physiological relevance of in vitro observations

    • Technical challenges in structural studies of membrane proteins

  • Integration and synthesis:

    • Develop mathematical models of the interconnected TCSs

    • Create comprehensive regulatory maps integrating all data

    • Propose evolutionary scenarios for the development of this system

    • Identify potential biotechnological applications

This research framework provides a systematic approach to understanding the complex cross-regulation between YvfT/YvfU and DesK/DesR, addressing both mechanistic questions and potential applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.