Recombinant Bacillus subtilis Sensor histidine kinase yxjM (yxjM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare your order according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yxjM; BSU38900; Sensor histidine kinase YxjM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yxjM
Target Protein Sequence
MNGQTPARHYYKKLVPSLILILNCIQFLSHPTKADPILLAFVFAVYLAFIWIIPYVASTA VSLSIFIGLWLLTDFFWAVSGQEQGAAYFLIVFLMIYAAFRLPSRLSLIFTACLIGGNIL LLSSQGGSLNTIISNISIMLGLYVLFSSMRFRREARREAERNHAELAKMHVQLEHAHKEL QKAHAELQEASVLSLRYAVLEERTRIARDIHDSIGHELTSVIVQLQSLPYILKSSKEDSE KVIQNVLSVARECLQEVRSVVHQMGRSESMVGLTALRGLIHQVEERSGLHVSLDTAGLSE ESWPPNVSETIYRILQEALTNIIRHADASHAAAVISNDKSHLYVTITDDGQFTGSLTYGF GLTGMKERAEKAGGSLTFSAVQPSGLKIELSLPLMTTNKEQKDEQR
Uniprot No.

Target Background

Function
Probable member of the two-component regulatory system YxjM/YxjL. May activate YxjL by phosphorylation.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is yxjM and what role does it play in bacterial signaling?

Bacillus subtilis sensor histidine kinase yxjM (yxjM) is a membrane-embedded signal transduction protein that belongs to the widespread two-component signal transduction systems in bacteria. Similar to other sensor histidine kinases, yxjM functions by recognizing specific environmental or cellular stimuli and transducing this information across the cellular membrane . The protein contains a sensing domain that determines which stimuli it responds to, followed by a transmitter domain with histidine kinase activity (EC 2.7.13.3) . Upon stimulus detection, yxjM likely undergoes autophosphorylation at a conserved histidine residue and subsequently transfers this phosphoryl group to a cognate response regulator that functions as a transcription factor, thereby regulating gene expression in response to the detected signal .

To study yxjM's role experimentally, researchers typically employ gene knockout or depletion strategies followed by phenotypic characterization, complementation studies, and transcriptomic analysis to identify genes regulated by the yxjM signaling pathway.

How does the structure of yxjM compare to other well-characterized histidine kinases?

The yxjM protein follows the canonical structure of histidine kinases while maintaining distinctive features that define its specific function. Based on its amino acid sequence (406 amino acids), yxjM contains:

DomainPositionFunctionComparison to other HKs
N-terminal sensing domainVariable regionSignal detectionHighly variable across HKs, determines specificity
Transmembrane regionsHydrophobic stretchesMembrane anchoringSimilar hydrophobic character but variable sequence
HisKA domainCentral regionContains H-box with phosphorylatable histidineConserved across HKs but with sequence variations
HATPase_c domainC-terminal regionATP binding and hydrolysisHighly conserved with characteristic N-, G1-, F-, and G2-boxes

What expression systems are optimal for producing functional recombinant yxjM?

The production of functional recombinant yxjM requires careful consideration of expression systems to ensure proper folding, incorporation of transmembrane domains, and retention of kinase activity. Based on current research approaches for membrane-embedded histidine kinases:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli BL21(DE3)High yield, simple protocolPotential misfolding of membrane proteinsUse lower induction temperatures (16-18°C), reduce IPTG concentration
E. coli C41/C43Designed for membrane proteinsLower yield than standard strainsExtend growth time, optimize media composition
B. subtilis expressionNative environment, proper foldingMore complex genetic manipulationUse strong inducible promoters like Pspac or PxylA
Cell-free systemsAvoids toxicity issuesExpensive, limited scaleSupplement with lipid vesicles or nanodiscs

For optimal results, researchers should:

  • Include a mild detergent like n-dodecyl-β-D-maltoside (DDM) during purification to maintain protein stability

  • Use a storage buffer containing 50% glycerol and Tris-based buffer as indicated for the commercial preparation

  • Validate protein functionality through in vitro phosphorylation assays

  • Consider fusion tags (His, MBP, or GST) placed strategically to avoid interfering with transmembrane domains

The choice between full-length yxjM and truncated constructs depends on the specific research question, with soluble cytoplasmic domains being easier to express but potentially missing critical regulatory interactions.

How can researchers effectively analyze yxjM phosphorylation dynamics?

Analyzing yxjM phosphorylation dynamics is crucial for understanding its signaling mechanisms. Several methodological approaches can be employed:

  • Radiolabeling assays: Using [γ-32P]ATP to track phosphorylation events in purified protein systems. This approach allows quantitative measurement of:

    • Autophosphorylation kinetics

    • Phosphotransfer rates to cognate response regulators

    • Phosphatase activity

  • Phos-tag™ SDS-PAGE:

    • This technique separates phosphorylated and non-phosphorylated protein forms without radioactivity

    • Allows time-course analysis of phosphorylation states

    • Can be coupled with western blotting for specific detection

  • Mass spectrometry approaches:

    • Enables identification of specific phosphorylation sites

    • Can detect multiple phosphorylation events simultaneously

    • Provides insights into phosphorylation stoichiometry

  • FRET-based biosensors:

    • Construct fusion proteins between yxjM and fluorescent proteins

    • Monitor conformational changes upon phosphorylation in real-time

    • Allows in vivo studies under various conditions

The experimental workflow should include careful time-course measurements under standardized conditions, as histidine phosphorylation is notably labile at acidic pH and elevated temperatures. Researchers should maintain samples at neutral pH and include phosphatase inhibitors when appropriate, while recognizing that histidine phosphorylation is resistant to conventional phosphatase inhibitors that target Ser/Thr/Tyr phosphorylations .

What computational methods are most effective for modeling yxjM's transmembrane interactions?

Based on approaches used for similar histidine kinases, several computational methods can effectively model yxjM's transmembrane interactions:

  • Replica Exchange Molecular Dynamics (REX MD):

    • This advanced sampling technique has proven successful for modeling transmembrane helix complexes of histidine kinases like YycG

    • Enhances conformational space sampling through temperature-space random walks

    • Can predict structures of multihelical complexes in membrane environments

    • Requires implementation of appropriate implicit membrane models

  • Homology modeling followed by molecular dynamics refinement:

    • Begin with alignment to known histidine kinase structures

    • Build initial models using programs like MODELLER or SWISS-MODEL

    • Refine in explicit lipid bilayers using MD simulations (100-500 ns)

    • Validate models against experimental data when available

  • Evolutionary coupling analysis:

    • Uses co-evolution patterns in sequence alignments to identify residue pairs in close proximity

    • Tools like EVcouplings or RaptorX-Contact can predict contact maps

    • Constrains modeling to improve accuracy of structural predictions

  • Integrated approach workflow:

    1. Predict transmembrane regions using TMHMM or MEMSAT

    2. Generate initial models through homology or ab initio methods

    3. Embed in appropriate membrane models

    4. Run REX MD simulations (2,000-3,000 structures)

    5. Perform clustering analysis to identify representative structures

    6. Validate with mutagenesis or biophysical experiments

When implementing these methods, researchers should pay particular attention to:

  • Proper selection of force fields optimized for membrane proteins

  • Adequate sampling time and convergence assessment

  • Validation against experimental data when available

  • Consideration of protein-lipid interactions that may influence structure

How can site-directed mutagenesis elucidate the functional mechanisms of yxjM?

Site-directed mutagenesis represents a powerful approach to investigate the functional mechanisms of yxjM. Based on knowledge of other histidine kinases, a systematic mutagenesis strategy should target:

RegionTarget ResiduesExpected OutcomeValidation Method
Conserved histidinePhosphorylatable His in H-boxComplete loss of kinase activityIn vitro phosphorylation assay
ATP-binding siteG1-box and N-box residuesImpaired ATP binding and autophosphorylationATPase activity assay, thermal shift assay
Transmembrane helicesConserved residues (e.g., Ser, Thr, Gln)Altered signal perception or transductionReporter gene assays, phenotypic analysis
Dimerization interfaceResidues in the dimerization domainDisrupted dimerization and signalingSize exclusion chromatography, FRET assays
Stimulus-sensing regionN-terminal domain residuesAltered ligand specificity or binding affinityLigand binding assays, response to stimuli

For transmembrane regions, the YycG/YycI system provides valuable insights. The YycI transmembrane helix mutagenesis revealed that residues predicted to interact with other transmembrane helices significantly affected signaling when mutated, while mutations of membrane-exposed residues had minimal impact . A similar approach for yxjM would involve:

  • Generating a computational model of the transmembrane region

  • Identifying potentially interacting residues

  • Creating alanine substitutions or more dramatic changes (e.g., S→F, T→F)

  • Assessing the impact on kinase activity and downstream signaling

For validation, researchers should employ multiple complementary approaches, such as:

  • In vitro phosphorylation assays with purified proteins

  • Reporter gene assays monitoring downstream gene expression

  • Phenotypic analysis of mutant strains under relevant conditions

  • Structural confirmation via disulfide cross-linking or DEER spectroscopy

What methods are most effective for identifying the environmental stimuli sensed by yxjM?

Identifying the specific environmental stimuli sensed by yxjM requires a systematic approach combining genetic, biochemical, and physiological techniques:

  • Transcriptional profiling under varied conditions:

    • Expose B. subtilis to different environmental stresses (pH, temperature, osmolarity, nutrient limitation)

    • Monitor yxjM expression using qRT-PCR or reporter constructs

    • Conditions that alter yxjM expression may indicate potential stimuli

  • Phenotypic screening of yxjM mutants:

    • Create knockout or conditional mutants of yxjM

    • Screen for phenotypes under various growth conditions

    • Conditions showing differential growth between wild-type and mutant strains suggest relevant stimuli

  • Direct binding assays:

    • Purify the periplasmic/extracellular sensing domain of yxjM

    • Perform thermal shift assays with potential ligands

    • Use isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to quantify binding affinities

  • Systematic stimulus-response analysis:

    • Engineer strains with reporter genes downstream of yxjM-regulated promoters

    • Expose to a matrix of conditions in high-throughput format

    • Identify conditions that activate the signaling pathway

  • Comparative genomics approach:

    • Analyze gene neighborhood and co-occurrence patterns across bacterial species

    • Identify conserved genomic context that may indicate the physiological role

    • Look for sensing domains with sequence similarity to proteins of known function

When designing these experiments, researchers should consider that two-component systems often respond to multiple, sometimes subtle environmental cues, and their activity may be modulated by interaction with additional regulatory proteins similar to the YycGHI system .

How can researchers reliably measure yxjM kinase activity in vitro?

Reliable measurement of yxjM kinase activity in vitro requires careful experimental design and appropriate controls. A comprehensive approach includes:

  • Autophosphorylation assay:

    • Incubate purified yxjM with [γ-32P]ATP

    • Take time-course samples and analyze by SDS-PAGE and autoradiography

    • Quantify incorporation of 32P over time

    • Control conditions should include:

      • ATP-free controls

      • Heat-inactivated protein controls

      • Kinase-dead mutant (H→A in phosphorylation site)

  • Phosphotransfer profiling:

    • Pre-phosphorylate yxjM with [γ-32P]ATP

    • Add purified response regulator proteins

    • Monitor phosphotransfer kinetics by measuring:

      • Decrease in yxjM phosphorylation

      • Increase in response regulator phosphorylation

    • Test multiple potential response regulators to identify cognate partner

  • ATPase activity assay:

    • Measure ATP hydrolysis using:

      • Malachite green assay for phosphate release

      • Coupled enzymatic assay with pyruvate kinase/lactate dehydrogenase

    • Plot enzyme kinetics and determine Km and Vmax values

    • Test effects of potential regulatory factors

  • Optimized reaction conditions:

    ParameterRecommended RangeConsiderations
    Buffer50 mM Tris-HCl or HEPES, pH 7.5-8.0Avoid phosphate buffers that interfere with assays
    Salt100-150 mM KCl or NaClHigher salt may stabilize protein but reduce activity
    Divalent cations5-10 mM MgCl2Required cofactor for ATP hydrolysis
    ATP0.1-1 mM (for kinetics, 0.01-2 mM range)Include trace [γ-32P]ATP for radiolabeling
    Detergent0.01-0.05% DDM or similarCritical for transmembrane protein stability
    Temperature25-30°CBalance activity with stability
  • Data analysis considerations:

    • Perform reactions in technical triplicates

    • Include time-zero controls

    • Calculate initial reaction rates from linear phase

    • Use non-linear regression for enzyme kinetics parameters

    • Present data as specific activity (nmol phosphate/min/mg protein)

What strategies can overcome challenges in crystallizing sensor histidine kinases like yxjM?

Crystallizing membrane proteins like yxjM presents significant challenges due to their hydrophobic nature and conformational flexibility. Based on successful approaches with other histidine kinases, researchers should consider:

  • Construct design optimization:

    • Create a library of truncation constructs removing flexible regions

    • Design chimeric proteins fusing crystallizable proteins to stable domains

    • Remove predicted disordered regions based on computational analysis

    • Consider limited proteolysis to identify stable core domains

  • Crystallization chaperones:

    • Use antibody fragments (Fab, scFv) that bind rigidly to the protein

    • Employ nanobodies as crystallization chaperones

    • Consider fusion to T4 lysozyme or BRIL to provide crystal contacts

  • Membrane protein-specific approaches:

    • Lipidic cubic phase (LCP) crystallization

    • Bicelle crystallization methods

    • Detergent screening using high-throughput methods

    • Stabilizing mutations based on thermostability assays

  • Alternative structural approaches:

    • Cryo-electron microscopy for full-length protein

    • NMR for individual domains

    • X-ray free-electron laser (XFEL) for microcrystals

    • Integrative structural biology combining multiple techniques

  • Practical workflow:

    1. Express and purify multiple constructs

    2. Perform stability and homogeneity analysis (SEC-MALS, thermofluor)

    3. Screen detergents using high-throughput methods

    4. Set up crystallization trials with sparse matrix screens

    5. Optimize initial hits by varying:

      • Precipitant concentration

      • pH and buffer composition

      • Temperature

      • Additive screening

    6. Validate protein activity in final crystallization conditions

The success rates for crystallizing full-length sensor histidine kinases remain relatively low, but domain-based approaches have yielded important structural insights. Researchers should consider parallel structural approaches rather than relying solely on crystallography .

How can integration of computational simulations and experimental data enhance understanding of yxjM signal transduction?

An integrated approach combining computational simulations with experimental validation offers powerful insights into yxjM signal transduction mechanisms:

  • Iterative modeling and validation cycle:

    • Start with computational models of yxjM structure

    • Use models to predict key functional residues

    • Test predictions with targeted mutagenesis

    • Refine models based on experimental results

    • This approach proved successful for the YycGHI system, where REX MD simulations generated structural models that informed mutagenesis studies, confirming the accuracy of the computational predictions

  • Dynamic signal transduction modeling:

    • Molecular dynamics simulations to capture conformational changes

    • Targeted molecular dynamics to model transition between signaling states

    • Coarse-grained models to reach biologically relevant timescales

    • Markov state modeling to identify key intermediate states

  • Network-level integration:

    • Systems biology models incorporating:

      • Phosphorylation kinetics from in vitro experiments

      • Gene expression data from transcriptomics

      • Protein-protein interaction networks

    • Parameter fitting using experimental data

    • Sensitivity analysis to identify critical control points

  • Specific approaches to test computationally:

    Computational MethodExperimental ValidationInformation Gained
    TM helix interaction modelingDisulfide crosslinkingValidation of predicted interfaces
    Molecular dynamics of signal propagationDEER spectroscopyConformational changes during signaling
    Ligand docking simulationsBinding assays with mutantsKey residues for stimulus recognition
    Transition path samplingTime-resolved structural methodsEnergy barriers in signaling pathway
  • Implementation strategy:

    1. Generate hypotheses using computational methods

    2. Design experimental tests with clear positive/negative outcomes

    3. Refine models based on experimental results

    4. Cycle through multiple rounds of prediction and validation

    5. Progressively build more comprehensive models of signaling

This integrated approach has proven valuable for understanding complex signaling systems like YycG, where computational predictions of transmembrane helix interactions were successfully validated through mutagenesis . The same strategy applied to yxjM would likely yield important insights into its signaling mechanism.

What are common pitfalls in recombinant yxjM expression and how can they be overcome?

Recombinant expression of membrane proteins like yxjM presents several challenges that researchers should anticipate and address:

  • Toxicity to expression host:

    • Problem: Overexpression can disrupt membrane integrity

    • Solution: Use tightly controlled inducible promoters, lower induction levels (0.1-0.5 mM IPTG instead of 1 mM), and specialized expression strains (C41/C43)

  • Inclusion body formation:

    • Problem: Improper folding leading to aggregation

    • Solution: Lower expression temperature (16-20°C), co-express with chaperones (GroEL/GroES), optimize induction conditions, consider fusion partners (MBP, SUMO)

  • Low yield of functional protein:

    • Problem: Poor expression or loss during purification

    • Solution: Optimize codon usage, screen multiple constructs and tags, use mild detergents, implement stability screening to identify optimal buffer conditions

  • Verification of proper folding:

    • Problem: Difficult to assess native conformation

    • Solution: Perform activity assays, circular dichroism, thermal shift assays, and limited proteolysis to verify structural integrity

  • Detergent selection challenges:

    • Problem: Finding detergents that maintain protein activity

    • Solution: Screen multiple detergents using high-throughput approaches:

    Detergent ClassExamplesBest ForLimitations
    Mild non-ionicDDM, DM, OGInitial extractionMay form large micelles
    Maltoside-basedLMNG, UDMStability during purificationMore expensive
    ZwitterionicLDAO, Fos-cholineCrystallizationCan be denaturing
    AmphipolsA8-35, PMAL-C8Detergent-free studiesComplex handling
    Nanodiscs/SMALPsMSP1D1, SMANative-like environmentHeterogeneous preparations
  • Purification bottlenecks:

    • Problem: Co-purification of contaminants, aggregation during concentration

    • Solution: Implement multi-step purification (IMAC followed by size exclusion), optimize salt and glycerol concentrations, use stability-enhancing additives (50% glycerol as used for commercial preparations)

  • Storage and stability issues:

    • Problem: Activity loss during storage

    • Solution: Store in 50% glycerol at -20°C or -80°C, avoid repeated freeze-thaw cycles, aliquot after purification, validate activity after storage

Detailed protocols should be established with careful optimization at each step, from construct design through final storage, with activity assays to verify functionality throughout the process .

How can researchers distinguish between direct and indirect effects when studying yxjM signaling pathways?

Distinguishing between direct and indirect effects in complex signaling networks requires careful experimental design and multiple complementary approaches:

  • In vitro reconstitution:

    • Purify yxjM and potential interaction partners

    • Demonstrate direct phosphotransfer to response regulators

    • Show direct protein-protein interactions using methods like:

      • Surface plasmon resonance (SPR)

      • Isothermal titration calorimetry (ITC)

      • Fluorescence polarization

  • Genetic approaches:

    • Use epistasis analysis with double mutants

    • Employ suppressor screens to identify genetic interactions

    • Create point mutations that specifically disrupt particular interactions

    • Use CRISPR interference for precise temporal control of gene expression

  • Phosphoproteomics:

    • Compare phosphorylation profiles in wild-type vs. yxjM mutants

    • Use phosphorylation-specific antibodies for known targets

    • Implement time-course studies to establish sequence of events

    • Distinguish between fast (direct) and delayed (indirect) phosphorylation events

  • Synthetic biology validation:

    • Reconstitute minimal signaling pathways in heterologous hosts

    • Build simplified circuits with defined components

    • Test sufficiency of identified components for signal transduction

  • Chemical genetics approach:

    • Engineer analogue-sensitive yxjM variants

    • Use small molecule inhibitors with temporal control

    • Monitor immediate effects (likely direct) versus delayed effects (likely indirect)

  • Decision framework:

    Evidence TypeSupports Direct EffectSupports Indirect Effect
    TimingRapid response (seconds to minutes)Delayed response (tens of minutes to hours)
    In vitro reconstitutionActivity observed with purified componentsRequires additional factors
    Mutational analysisSingle residue changes abolish interactionRequires multiple mutations
    Structural evidenceDirect contact in structural studiesNo direct contact observed
    Genetic epistasisGene operates at same level in pathwayGene operates at different level

For the well-studied YycG system, the direct interaction with YycH and YycI was established through multiple approaches, including truncation studies showing that individual transmembrane helices were sufficient to adjust kinase activity, computational modeling of interactions, and mutagenesis validation of the model . Similar multifaceted approaches should be applied to establishing the direct and indirect interactions in yxjM signaling pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.