Recombinant Bacillus subtilis Sensor protein lytS (lytS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lytS; BSU28930; Sensor protein LytS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
lytS
Target Protein Sequence
MIHLMIMMLERVGIIVILGFILAHTKLFRQALQNQDGYKGKAILISIFSLFSIISNYTGI EIQRNMIVNNDWVFTIDPSGSIANTRILGVEIGGLLGGPFVGAGIGILAGLHRFSLGGST ALSCAVSSILAGVLAGLIGRYFTKRYRMPTPRIAALVGIGMESLQMIIILLMAKPFSDAW ELVSMIGIPMILINGTGSFIFLSIIQAIIRKEEQARALETHRVLTIADQTLPFFRQGLNE NSCKSVAAIIHKLTGTDAVSLTDKEKILAHVGAGMDHHIPSKSLITGLSKKVIKTGHIMK AISQEEIECTHAECPLHAAIVLPLTSNGNTIGTLKMYFKSPAGLSQVEEELAEGLAMLFS TQLELGEAELQSKLLKDAEIKALQAQVNPHFLFNAINTISALCRTDVEKTRKLLLQLSVY FRSNLQGARQLLIPLSKELNHLNAYLSLEQARFPGKYKIELNIDSRLEQIEIPPFVLQVL VENALRHAFPKKQDICKVTVCVLSDDASVYMKVADNGRGIPPDVLPELGKKPFPSKEGTG TALYNLNQRLIGLFGQQAALHISSEVHKGTEVSFQVPMQQMKEGEEHAQGVNS
Uniprot No.

Target Background

Function
LytS is a member of the two-component regulatory system LytS/LytT, which likely regulates genes involved in cell wall metabolism.
Gene References Into Functions
  1. YsbA and its two-component regulator LytST are crucial for growth on pyruvate. Furthermore, deleting ysbA and lytS significantly reduces pyruvate consumption. PMID: 27422364
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Sensor protein LytS and what is its primary function in Bacillus subtilis?

Sensor protein LytS (EC 2.7.13.3) is a histidine kinase that functions as part of the two-component regulatory system LytST in Bacillus subtilis. While initially annotated as a putative antiholin-like protein potentially involved in cell death regulation, research has revealed that its primary function relates to pyruvate metabolism . LytS is essential for pyruvate utilization in B. subtilis, with deletion of lytS significantly reducing pyruvate consumption . The protein is likely involved in environmental sensing, allowing the bacterium to detect and respond to pyruvate availability in its surroundings.

How is the lytS gene regulated in Bacillus subtilis?

The lytS gene (locus tag BSU28930) is regulated through a complex network of transcriptional controls in B. subtilis. Research indicates that the LytST system induces ysbA transcription in the presence of pyruvate . This suggests that pyruvate or related metabolites may serve as direct or indirect signals for lytS expression. The regulatory network likely involves feedback mechanisms where the presence of pyruvate in the environment triggers activation of the LytST system, which then further regulates genes involved in pyruvate utilization including ysbA. This regulatory pattern is consistent with B. subtilis' ability to adapt to changing nutrient conditions in its plant-associated ecological niche .

What is the mechanism by which LytS senses pyruvate in the environment?

The precise molecular mechanism of pyruvate sensing by LytS involves its transmembrane domains that detect extracellular pyruvate. As a histidine kinase, LytS likely undergoes autophosphorylation upon binding pyruvate, creating a phosphoryl group that is subsequently transferred to its cognate response regulator LytT . This phosphorelay mechanism activates LytT, which then regulates the transcription of target genes, particularly ysbA, which is essential for pyruvate utilization.

The sensing domain of LytS appears specialized for pyruvate recognition, as demonstrated by experiments showing that deletion of lytS specifically affects pyruvate metabolism without broadly disrupting other metabolic pathways. This sensing mechanism is critical for B. subtilis adaptation to environments where pyruvate is an available carbon source, particularly relevant since B. subtilis can excrete pyruvate as an overflow metabolite in rich media conditions .

How does the LytST system in B. subtilis compare to similar two-component systems in other bacterial species?

The LytST system in B. subtilis shows functional homology with two-component systems in other bacterial species, including:

SpeciesSystemFunctionSimilarity to B. subtilis LytST
Staphylococcus aureusLytSROriginally associated with cell death and lysis regulationHigh sequence homology, different functional role
Bacillus anthracisLytS homolog (BA_5692)Predicted sensor histidine kinaseConserved functional domains
Bacillus cereusLytS (BC5441)Autolysin sensor kinaseSimilar structure and partial functional overlap
Staphylococcus epidermidisLytS (SE2011)Two-component sensor histidine kinaseConserved sensing mechanism

While the LytST system in B. subtilis is primarily involved in pyruvate metabolism, homologous systems in other species may serve different physiological functions despite structural similarities. These differences highlight the evolutionary adaptation of two-component systems to specific ecological niches and metabolic requirements of different bacterial species .

What are the implications of the LytST system for bacterial adaptation to environmental conditions?

The LytST system plays a crucial role in B. subtilis adaptation to environmental conditions, particularly those involving fluctuating carbon source availability. Research indicates that:

  • B. subtilis excrets pyruvate as an overflow metabolite in rich medium, suggesting pyruvate could be a common nutrient in its natural environment

  • The LytST system allows the bacterium to sense and utilize this pyruvate, providing a competitive advantage

  • This adaptation is particularly relevant for B. subtilis' plant-associated ecological niche, where plant exudates may contain pyruvate or precursor molecules

The ability to sense and efficiently utilize pyruvate through the LytST system represents an important adaptive strategy that likely contributes to B. subtilis' ecological success. Furthermore, this system may be involved in complex bacterial-fungal interactions, as indicated by dual-transcriptome approaches revealing that such interactions affect the metabolism of both organisms .

What experimental designs are optimal for studying LytS function?

Latin Square experimental designs are particularly valuable for studying LytS function as they allow researchers to control for multiple sources of variability simultaneously. A Latin Square design arranges treatments in a square matrix where each treatment appears exactly once in each row and column, ensuring systematic control of two extraneous variables .

For LytS research, this approach can be implemented by:

  • Arranging different strains (wild-type vs. lytS mutants) across different growth conditions and sampling times

  • Controlling for batch effects in protein expression studies

  • Systematically testing different potential ligands for LytS sensing

A sample Latin Square design for studying LytS function with 4 treatments might look like:

Time Point 1Time Point 2Time Point 3Time Point 4
Condition AWTΔlytSΔlytSTΔysbA
Condition BΔlytSΔlytSTΔysbAWT
Condition CΔlytSTΔysbAWTΔlytS
Condition DΔysbAWTΔlytSΔlytST

This design reduces systematic bias (batch effects) which can obscure biological differences between samples . The design is particularly valuable for LytS research where small differences in pyruvate utilization may need to be detected against background variability.

What methods are most effective for producing recombinant B. subtilis Sensor protein LytS?

Several expression systems have been successfully used to produce recombinant B. subtilis LytS protein:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliHigh expression levels, simple culture conditionsPotential issues with membrane protein folding≥85% purity by SDS-PAGE
Cell-Free ExpressionAvoids toxicity issues, rapid productionHigher cost, lower scalability≥85% purity by SDS-PAGE
BaculovirusBetter for complex proteins, eukaryotic modificationsMore complex system, longer production time≥85% purity by SDS-PAGE
Mammalian CellBest for complex folding, post-translational modificationsMost complex system, highest cost≥85% purity by SDS-PAGE

For membrane proteins like LytS, cell-free expression systems often provide advantages by avoiding the toxicity sometimes associated with overexpressing membrane proteins in living cells. The method typically involves:

  • PCR amplification of the lytS gene from B. subtilis genomic DNA

  • Cloning into an appropriate expression vector

  • Expression using cell-free systems with appropriate detergents for membrane protein solubilization

  • Purification using affinity chromatography (typically His-tag based)

This approach regularly achieves ≥85% purity as determined by SDS-PAGE, sufficient for most research applications .

How can researchers verify the activity of recombinant LytS protein?

Verifying the activity of recombinant LytS protein is crucial for functional studies. Effective approaches include:

  • Autophosphorylation assays: Measuring the histidine kinase activity through ATP-dependent autophosphorylation, typically using radioactive ATP (γ-³²P-ATP) or phospho-specific antibodies

  • Phosphotransfer assays: Testing the ability of phosphorylated LytS to transfer its phosphoryl group to its cognate response regulator LytT

  • Pyruvate binding studies: Using techniques such as:

    • Isothermal titration calorimetry (ITC) to measure direct binding affinity

    • Differential scanning fluorimetry (DSF) to assess thermal stability shifts upon pyruvate binding

    • Surface plasmon resonance (SPR) to determine binding kinetics

  • Functional complementation: Testing whether the recombinant protein can restore pyruvate utilization in ΔlytS B. subtilis strains

A comprehensive activity verification typically combines multiple approaches to ensure both structural integrity and functional competence of the recombinant protein.

What techniques are most effective for studying LytS-pyruvate interactions and downstream signaling?

Several advanced techniques provide valuable insights into LytS-pyruvate interactions and subsequent signaling cascades:

  • Structural biology approaches:

    • X-ray crystallography of the LytS sensory domain with and without pyruvate

    • Cryo-electron microscopy for full-length protein structure determination

    • NMR spectroscopy for detecting conformational changes upon ligand binding

  • Transcriptomic and proteomic analyses:

    • RNA-seq to identify genes regulated by the LytST system in response to pyruvate

    • ChIP-seq to map LytT binding sites throughout the genome

    • Proteomics to identify proteins whose expression changes in response to LytST activation

  • In vivo biosensors:

    • FRET-based sensors to detect conformational changes in LytS upon pyruvate binding

    • Transcriptional reporters (e.g., luciferase, GFP) driven by LytT-regulated promoters

  • Biochemical assays:

    • Electrophoretic mobility shift assays (EMSA) to study LytT binding to target promoters

    • DNase I footprinting to precisely map binding sites

    • Phosphorylation kinetics to understand signal transduction dynamics

These techniques, particularly when used in combination, provide a comprehensive understanding of how LytS senses pyruvate and how this signal is transmitted through the LytST two-component system to regulate downstream metabolic processes.

How can the study of LytS contribute to understanding bacterial metabolism and adaptation?

Research on LytS provides valuable insights into bacterial metabolism and adaptation mechanisms:

  • Carbon source utilization: Understanding how bacteria sense and adapt to different carbon sources like pyruvate enhances our knowledge of bacterial metabolism flexibility

  • Signal transduction paradigms: LytS studies reveal mechanisms of environmental sensing through two-component systems, a fundamental bacterial signaling paradigm

  • Metabolic network modeling: Incorporating LytS-mediated pyruvate sensing into metabolic models improves prediction of bacterial responses to changing environments

  • Ecological adaptations: The role of LytS in B. subtilis' plant-associated lifestyle reveals mechanisms of niche adaptation and bacterial-plant interactions

Future research directions could explore how the LytST system interacts with other regulatory networks to coordinate global metabolic responses, potentially revealing new paradigms in bacterial adaptation strategies.

What challenges exist in translating in vitro findings about LytS to in vivo bacterial physiology?

Several challenges complicate the translation of in vitro findings about LytS to in vivo bacterial physiology:

  • Environmental complexity: Laboratory conditions simplify the complex environmental signals B. subtilis encounters in natural habitats

  • Temporal dynamics: In vitro studies often capture static timepoints rather than the dynamic responses that occur in vivo

  • System integration: Isolating LytS function experimentally may miss important interactions with other regulatory systems

  • Physiological states: Laboratory cultures may not represent all physiological states B. subtilis adopts in nature (e.g., biofilm formation, sporulation)

Addressing these challenges requires integrative approaches combining controlled laboratory experiments with more naturalistic studies, potentially using:

  • Microfluidic systems that can simulate changing environmental conditions

  • In situ transcriptomics to capture gene expression in natural habitats

  • Multi-omics approaches to capture system-wide responses to pyruvate

  • Mathematical modeling to integrate data across scales and conditions

These approaches can help bridge the gap between reductionist in vitro studies and the complex reality of bacterial physiology in natural environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.