Recombinant Bacillus subtilis Signaling protein ykoW (ykoW)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bacillus subtilis signaling protein YkoW, later reclassified as Diguanylate Cyclase W (DgcW), is a key enzyme involved in cyclic di-GMP (c-di-GMP) metabolism. C-di-GMP is a bacterial second messenger regulating motility, biofilm formation, and virulence. DgcW synthesizes c-di-GMP via its GGDEF domain and is part of a conserved signaling network in B. subtilis. This article synthesizes structural, functional, and biotechnological insights into recombinant DgcW, drawing from biochemical, genetic, and systems biology studies.

Protein Structure and Functional Domains

Recombinant DgcW (formerly YkoW) comprises two primary domains:

  • GGDEF domain: Catalyzes c-di-GMP synthesis from GTP via diguanylate cyclase activity.

  • PAS domain: A sensory domain that modulates enzymatic activity, potentially in response to environmental signals .

Table 1: Domain Architecture of DgcW

DomainFunctionKey Residues/Features
GGDEFc-di-GMP synthesisConserved GGDEF motif
PASSignal sensing/modulationEnhances GGDEF activity in vitro

Enzymatic Activity and Regulation

DgcW exhibits diguanylate cyclase activity both in vivo and in vitro:

  • In vivo: Overexpression in B. subtilis elevates intracellular c-di-GMP levels, as confirmed by LC–MS/MS .

  • In vitro: Purified DgcW produces c-di-GMP from GTP, with activity enhanced by its PAS domain .

Table 2: Biochemical Properties of Recombinant DgcW

PropertyValue/ObservationReference
Catalytic activity45 nmol c-di-GMP/min/mg (in vitro)
Mg²⁺ dependenceRequired for GTP binding
PAS domain roleEnhances cyclase activity by ~3-fold

Role in c-di-GMP Signaling and Phenotypic Effects

DgcW is one of three active diguanylate cyclases (with DgcK and DgcP) in B. subtilis. Key functional roles include:

  • Motility inhibition: Elevated c-di-GMP levels reduce swarming motility by suppressing flagellar activity .

  • Biofilm modulation: Indirect influence on biofilm architecture via c-di-GMP interplay with phosphodiesterases (e.g., PdeH) .

Genetic Interactions:

  • ΔdgcW mutants show reduced c-di-GMP levels but no motility defects, suggesting redundancy with DgcK/DgcP .

  • Epistatic interactions with PdeH (a c-di-GMP phosphodiesterase) fine-tune c-di-GMP homeostasis .

Recombinant Production and Purification

Recombinant DgcW is typically produced in heterologous hosts like E. coli or B. subtilis strains engineered for high-yield expression:

  • Expression systems: Plasmid-based IPTG-inducible systems (e.g., Physpank promoter) .

  • Purification: Affinity chromatography (e.g., His-tagged constructs) .

Table 3: Example Production Parameters

ParameterDetailsSource
Host strainE. coli BL21(DE3) or B. subtilis
TagHis₆ (C-terminal/N-terminal)
Yield~5–10 mg/L culture (varies by system)

Applications in Biotechnology

While direct applications of recombinant DgcW are exploratory, B. subtilis is a GRAS-certified host for recombinant protein production, with advantages:

  • Endotoxin-free: Critical for therapeutic protein production .

  • Secretion efficiency: Engineered strains optimize extracellular yields .

Challenges and Future Directions

  • Functional redundancy: Overlapping roles of DgcW, DgcK, and DgcP complicate phenotypic analysis .

  • Sensory input mapping: PAS domain signals remain uncharacterized .

  • Biotechnological adaptation: Leveraging DgcW for synthetic biology requires precise c-di-GMP tuning .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them during the order placement. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. We kindly request you to contact your local distributors for specific delivery timelines.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize its inclusion.
Synonyms
ykoW; BSU13420; Signaling protein YkoW
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-800
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ykoW
Target Protein Sequence
MEIHVTYNTTLICLSILIACTASYISLELSRKVTINTGLKSKIWLIGGSLIMGFGIWSMH FVGMMAVHMEMPMEYEFMPLMAAIGASVSGSFVSLYFVSRHILTYYRLLTGSVVLGASIA SMHYIGMSAISRVMIIYEPILFTVSIIIAIAASFVSLKIFFDLAVKKHSEHLIFYKGVSS IVMGIGISGMHYTGMLAATFHKDMAPPGSHMEVQTFHWSIFVTLIIFCIQTLLLFSSHAD RKFIKQSERIKDNEQRFQSLIVHNIDAIFILSLEGDIISSNHAGEEMISKFGFSMHDWRN YTSLKVKRLFEQVKKDKQAMNSDSDLITEKGQFHLNITLIPVEVNQELDSIYVICKDMTK QYKAEKEIHRMAHYDSLTDLPNRRHAISHLTKVLNREHSLHYNTVVFFLDLNRFKVINDA LGHNVGDQLLQFAAKRLSSVVPDNGFIARLGGDEFIIILTDANTGTGEADVLARKIIQKF KKPFKIQDHTLVTSVSIGIAISPKDGTDGLELMKKADMAMYAAKERNKSKYRYYSFSIGN KETVKLNQEMVLREAIENDRFVLHYQPQFSVKKQKMTGAEALIRLVTPDGQLRPPGEFIG VAEETGLIIDIGKWIIDEACKQARIWHDKGYDLSVAINISARQFQSKDLIPLIKDTLNKY QLPPQLLEVEVTESMTMDNLNHSKKVLSSLTELGIRISIDDFGTGHSSLSYLKDFPIHRL KIDKSFIDDIQTHPKSEQITGAIIAMGHQLSLQVIAEGVENAAQKQLLFEKGCDHLQGFF FSRPIPPEQFEQFIIEQPSQ
Uniprot No.

Target Background

Function
This protein likely plays a role in signaling, but its precise physiological function remains undefined.
Gene References Into Functions
  1. Correction: ykoW was renamed DgcW PMID: 23893111
  2. ykoW was renamed dgcK and primarily encodes diguanylate cyclase PMID: 23893111
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the hypothesized function of ykoW in Bacillus subtilis?

The ykoW protein is classified as a signaling protein in B. subtilis, suggesting its involvement in signal transduction pathways. Research evidence indicates that ykoW likely functions within the cyclic di-GMP (c-di-GMP) signaling system in B. subtilis . This system directly inhibits motility and influences biofilm formation, suggesting that ykoW may play a role in bacterial responses to environmental changes, particularly during the transition from motile to sessile states. The protein's extensive transmembrane regions suggest it may serve as a sensor for external stimuli, transducing signals across the bacterial membrane .

What are the recommended methods for expressing and purifying recombinant ykoW protein?

For optimal expression and purification of recombinant ykoW protein, the following methodological approach is recommended:

  • Expression System Selection: E. coli is the preferred heterologous expression system due to its high yield and ease of genetic manipulation .

  • Vector Design: Construct an expression vector with:

    • N-terminal His-tag for affinity purification

    • Strong inducible promoter (e.g., T7)

    • Appropriate antibiotic resistance marker

  • Expression Protocol:

    • Transform the construct into E. coli BL21(DE3) or similar expression strain

    • Grow cultures at 37°C until mid-log phase (OD600 ~0.6)

    • Induce with IPTG (0.1-1.0 mM)

    • Reduce temperature to 18-25°C during induction to improve protein folding

    • Continue expression for 4-16 hours

  • Purification Strategy:

    • Lyse cells using sonication or pressure-based methods in a Tris/PBS-based buffer (pH 8.0)

    • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Include 6% trehalose in storage buffer to maintain protein stability

    • Elute with imidazole and dialyze to remove excess imidazole

    • Concentrate and store as aliquots at -20°C/-80°C

  • Quality Control:

    • Verify purity >90% using SDS-PAGE

    • Confirm identity via western blot or mass spectrometry

    • Test functionality through appropriate binding or activity assays

How can I establish an experimental design to study ykoW's role in bacterial signaling?

To effectively study ykoW's role in bacterial signaling, implement a multi-faceted experimental design:

  • Genetic Manipulation Approach:

    • Generate knockout mutants (ΔykoW) using allelic exchange techniques

    • Create point mutations in key domains to identify functional residues

    • Develop complementation strains to confirm phenotypes

    • Consider using the B. subtilis PY79 strain for consistency with established protocols

  • Phenotypic Analysis:

    • Assess motility using swimming and swarming assays

    • Evaluate biofilm formation capacity using standard microtiter plate or pellicle assays

    • Compare growth kinetics between wild-type and mutant strains

    • Use microscopy to examine cell morphology and flagellation

  • Molecular Interaction Studies:

    • Employ yeast two-hybrid screening to identify interaction partners

    • Confirm interactions using pull-down assays with the purified His-tagged protein

    • Use bacterial two-hybrid systems for in vivo validation

  • Signaling Pathway Analysis:

    • Measure intracellular c-di-GMP levels in wild-type vs. mutant strains

    • Assess phosphorylation states using phospho-specific antibodies

    • Investigate cross-talk with other signaling pathways

  • Controls and Variables Management:

    • Include wild-type B. subtilis as positive control

    • Use strains with mutations in known signaling proteins as comparative controls

    • Control for environmental variables that might affect signaling (temperature, nutrients, oxygen levels)

  • Data Analysis:

    • Apply appropriate statistical methods to validate significance of phenotypic differences

    • Use multiple biological and technical replicates (minimum n=3)

    • Consider combining quantitative with qualitative assessment methods

How does ykoW interact with the cyclic di-GMP signaling network in B. subtilis?

The interaction between ykoW and the cyclic di-GMP signaling network appears to be complex and multifaceted. Current research suggests the following mechanistic model:

  • Regulatory Context:
    The ykoW protein functions within a larger signaling network that involves the master regulator Spo0A~P. Evidence indicates that related components in this system (such as yuxH) are under negative control of Spo0A~P, suggesting ykoW may also be subject to similar regulation during stationary phase entry .

  • Signaling Cascade Components:
    Research has identified a functioning c-di-GMP signaling system in B. subtilis that directly inhibits motility and influences biofilm formation. The system likely involves several key components:

    ComponentFunctionInteraction with ykoW
    Diguanylate cyclasesSynthesize c-di-GMPPotential upstream regulators
    PhosphodiesterasesDegrade c-di-GMPMay counterbalance ykoW activity
    YpfAInhibits motilityPossible functional overlap or interaction
    YuxHUnder Spo0A~P controlPotential regulatory relationship
  • Signaling Mechanism:
    Based on phosphorylation interaction network studies, ykoW may participate in complex phosphorylation cascades involving tyrosine kinases and phosphatases. This suggests a multi-step signaling mechanism where phosphorylation states of ykoW might modulate its activity or interactions with other pathway components .

  • Methodological Approach to Study Interactions:

    • Use phosphoproteomics to identify phosphorylation sites on ykoW

    • Employ bacterial adenylate cyclase two-hybrid (BACTH) system to map protein-protein interactions within the network

    • Measure c-di-GMP levels in response to ykoW overexpression or deletion

    • Create fusion proteins with fluorescent tags to visualize localization and potential co-localization with other signaling components

What role might ykoW play in B. subtilis adaptation to environmental stresses?

Research suggests ykoW may function as a critical component in B. subtilis adaptation to environmental stresses through the following mechanisms:

  • Stress-Responsive Signaling:

    • The transmembrane domain architecture of ykoW suggests it may function as a sensor for external stimuli, potentially detecting changes in osmolarity, pH, or nutrient availability

    • Its integration with the c-di-GMP signaling pathway positions it to potentially mediate transitions between motile and sessile lifestyles in response to stress conditions

  • Biofilm Formation Regulation:

    • Evidence indicates that the c-di-GMP signaling system in B. subtilis influences biofilm formation, a key stress response

    • YkoW may modulate biofilm development through direct or indirect mechanisms, potentially by affecting extracellular matrix production or cell-cell adhesion properties

  • Experimental Approach to Test Environmental Response Functions:

    • Subject wild-type and ΔykoW mutant strains to various stressors (osmotic shock, nutrient limitation, oxidative stress)

    • Compare survival rates, morphological changes, and gene expression profiles

    • Utilize MSgg or 2× SGG biofilm-inducing media to assess differences in biofilm architecture and robustness under stress conditions

    • Employ fluorescent reporters to monitor spatiotemporal activation of stress response pathways in relation to ykoW activity

  • Methodological Considerations for Stress Response Studies:

    • Careful control of environmental conditions is essential

    • Multiple stress parameters should be tested independently and in combination

    • Time-course experiments are crucial to distinguish immediate from adaptive responses

    • Both planktonic and biofilm growth modes should be examined

Why is my recombinant ykoW protein showing low solubility, and how can I improve it?

Low solubility of recombinant ykoW protein is a common challenge due to its transmembrane domains. Here's a systematic approach to address this issue:

  • Causes of Low Solubility:

    • Hydrophobic transmembrane regions promoting aggregation

    • Improper folding in heterologous expression systems

    • Formation of inclusion bodies during overexpression

    • Insufficient chaperone availability in E. coli host

  • Optimization Strategies:

    ApproachMethodologyExpected Outcome
    Expression temperature reductionLower to 16-20°C post-inductionSlows protein synthesis, allowing proper folding
    Solubility tag additionFuse with MBP, SUMO, or ThioredoxinEnhances solubility through partner protein properties
    Detergent selectionScreen various detergents (DDM, LDAO, etc.)Solubilizes membrane proteins
    Co-expression with chaperonesAdd chaperone-expressing plasmid (GroEL/ES, DnaK/J)Assists proper protein folding
    Domain-based approachExpress soluble domains separatelyAvoids transmembrane region aggregation
  • Purification Protocol Modifications:

    • Include 5-10% glycerol in all buffers to prevent aggregation

    • Add mild detergents (0.1% NP-40 or Triton X-100) in lysis and purification buffers

    • Consider using urea or guanidine HCl for initial solubilization, followed by gradual removal through dialysis

    • Implement on-column refolding during purification

  • Quality Control Tests:

    • Dynamic light scattering to assess aggregation state

    • Size exclusion chromatography to verify monodispersity

    • Circular dichroism to confirm secondary structure formation

    • Thermal shift assays to identify stabilizing buffer conditions

How can I address data inconsistencies when studying ykoW's effects on biofilm formation?

Data inconsistencies in biofilm formation studies with ykoW can arise from multiple sources. Here's a methodological framework to address these challenges:

  • Common Sources of Inconsistency:

    • Variations in media composition affecting biofilm development

    • Inconsistent surface properties of culture vessels

    • Strain background genetic differences

    • Environmental fluctuations (temperature, humidity)

    • Biofilm quantification method limitations

  • Standardization Protocol:

    • Use chemically defined media with precisely controlled components

    • Implement biofilm-inducing medium MSgg or 2× SGG consistently across experiments

    • Standardize growth vessels (same manufacturer, lot number, pre-treatment)

    • Control temperature to ±0.5°C and minimize vibration during incubation

    • Include standard curves with each quantification assay

  • Comprehensive Experimental Design:

    • Perform time course studies (24h, 48h, 72h) to capture dynamic changes

    • Compare multiple surfaces (polystyrene, glass, silicon)

    • Test both static and flow conditions for biofilm development

    • Include positive controls (known biofilm formers) and negative controls (biofilm-deficient mutants)

    • Blind scoring when conducting manual assessments

  • Multi-method Validation Approach:

    • Crystal violet staining for total biomass

    • Confocal microscopy for 3D architecture analysis

    • Viable count enumeration for living cells

    • Fluorescent reporter strains to monitor gene expression

    • Biochemical analysis of matrix components (polysaccharides, proteins, DNA)

  • Statistical Robustness:

    • Minimum of 6 biological replicates per condition

    • Use appropriate statistical tests for non-normally distributed data

    • Apply ANOVA with post-hoc tests for multiple comparisons

    • Consider developing a standardized effect size metric specific to your experimental system

How can I design transgenic fluorescent reporters to study ykoW localization and dynamics?

Creating effective fluorescent reporters for ykoW requires careful design considerations to maintain protein function while enabling visualization. Here's a comprehensive methodology:

  • Reporter Design Strategy:

    • Terminal fusion approaches: Evaluate both N- and C-terminal fusions as transmembrane topology may affect functionality

    • Internal fusion: Identify non-critical loop regions using topology prediction tools for fluorescent protein insertion

    • Split fluorescent protein complementation for interaction studies with potential partners

  • Fluorescent Protein Selection:

    • msfGFP (monomeric superfolder GFP) for standard applications

    • mCherry for red spectrum and potential FRET applications

    • Photoactivatable fluorescent proteins (PA-GFP) for pulse-chase dynamics

    • Consider brightness, maturation time, and pH sensitivity based on experimental needs

  • Genetic Integration Methods:

    • Use Campbell-type integration at the native locus to maintain native regulation

    • Implement CRISPR-Cas9 for scarless integration

    • Consider inducible promoters for controlled expression levels

    • Reference established transformation protocols for B. subtilis PY79 strain

  • Validation Experiments:

    • Confirm protein functionality through complementation of ykoW knockout phenotypes

    • Verify localization pattern with immunofluorescence using anti-ykoW antibodies

    • Conduct western blots to ensure appropriate fusion protein size and expression levels

    • Perform controls with unfused fluorescent proteins to exclude artifactual localization

  • Advanced Imaging Applications:

    • Time-lapse microscopy to track dynamics during cell cycle or stress response

    • FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

    • Single-molecule tracking for diffusion coefficient determination

    • Super-resolution microscopy (PALM/STORM) for precise subcellular localization

What approaches should I use to investigate post-translational modifications of ykoW?

Post-translational modifications (PTMs) of ykoW likely play crucial roles in its signaling functions. Here's a methodological framework to comprehensively study these modifications:

  • PTM Prediction and Targeting:

    • Use bioinformatic tools to predict potential phosphorylation, glycosylation, or other modification sites

    • Focus on conserved residues across bacterial species

    • Pay special attention to regions implicated in signaling functions

    • Create targeted mutation libraries of predicted modification sites

  • Mass Spectrometry Approaches:

    • Sample preparation: Optimize extraction and enrichment protocols for membrane proteins

    • Employ titanium dioxide enrichment for phosphopeptides

    • Use multiple proteases (trypsin, chymotrypsin, Glu-C) for improved sequence coverage

    • Implement targeted MS approaches (PRM, SRM) for low-abundance modifications

    • Apply label-free quantification to compare modification states across conditions

  • Modification-Specific Assay Development:

    PTM TypeMethodologyDetection Approach
    PhosphorylationPhos-tag SDS-PAGEMobility shift visualization
    PhosphorylationPhospho-specific antibodiesWestern blot/immunofluorescence
    GlycosylationLectin-based detectionAffinity purification, blotting
    AcetylationAnti-acetyl antibodiesImmunoprecipitation, western blot
    Multiple PTMsSite-directed mutagenesisFunctional impact assessment
  • Dynamic PTM Profiling:

    • Compare modifications across growth phases

    • Profile changes during stress responses

    • Map modifications in response to c-di-GMP level fluctuations

    • Correlate with protein-protein interaction networks

  • Integration with Phosphorylation Networks:

    • Evaluate interactions with known bacterial phosphorylation systems

    • Test substrates of identified kinases for cross-reactivity

    • Map relationships within the B. subtilis phosphorylation interaction network

    • Investigate potential crosstalk with other post-translational modification systems

What are promising approaches for identifying the small molecule ligands or signals recognized by ykoW?

Identifying ligands or signals recognized by ykoW requires a systematic approach combining computational, biochemical, and genetic methods:

  • In Silico Ligand Prediction:

    • Homology modeling based on related bacterial sensors

    • Molecular docking with libraries of potential bacterial signaling molecules

    • Cavity detection algorithms to identify potential binding pockets

    • MD simulations to study domain dynamics and potential ligand interaction sites

  • Biochemical Screening Methods:

    • Differential scanning fluorimetry (thermal shift assays) with candidate ligands

    • Surface plasmon resonance with immobilized protein

    • Isothermal titration calorimetry for binding affinity determination

    • Fluorescence-based ligand displacement assays

    • Hydrogen-deuterium exchange mass spectrometry to identify binding regions

  • Genetic and Functional Approaches:

    • Construct a reporter system linking ykoW activation to gene expression

    • Screen environmental conditions that activate the reporter system

    • Create chimeric receptors with known ligand-binding domains to validate signaling function

    • Employ transposon mutagenesis to identify genes affecting ykoW-dependent pathways

  • Structural Biology Integration:

    • X-ray crystallography of soluble domains with and without candidate ligands

    • Cryo-EM for full-length protein structural analysis

    • NMR for studying ligand-induced conformational changes in soluble domains

    • Cross-linking mass spectrometry to capture transient interactions

  • Environmental Signal Correlation:

    • Systematically test cellular responses to environmentally relevant signals (pH shifts, osmotic stress, nutrient limitation)

    • Analyze ykoW activation patterns during B. subtilis lifecycle transitions

    • Compare wild-type and mutant responses to potential external triggers

How can advanced research design approaches enhance our understanding of ykoW's role in bacterial communication networks?

Advanced research design approaches can significantly deepen our understanding of ykoW's role in bacterial communication networks through these methodological innovations:

  • Systems Biology Integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network modeling to predict system-wide effects of ykoW perturbation

    • Flux balance analysis to determine metabolic consequences of signaling changes

    • Agent-based modeling of bacterial communities with variable ykoW activity levels

  • Spatial and Temporal Resolution Enhancements:

    • Microfluidic devices for precise environmental control and single-cell analysis

    • Optogenetic control of ykoW activity for precise temporal manipulation

    • 4D imaging combining high-resolution microscopy with time-series analysis

    • Spatially resolved transcriptomics to map expression changes in bacterial communities

  • Innovative Experimental Designs:

    • Synthetic community approaches with defined bacterial consortia

    • Biomimetic surfaces mimicking natural bacterial habitats

    • Dual-species biofilm models to study interspecies communication

    • In situ monitoring systems for real-time activity tracking

  • Cross-disciplinary Methods Integration:

    • Biophysical approaches to measure mechanical properties of ykoW-influenced biofilms

    • Chemical biology tools for targeted protein manipulation

    • Machine learning for pattern recognition in complex phenotypic data

    • Adaptive laboratory evolution to identify compensation mechanisms for ykoW dysfunction

  • Translational Research Connections:

    • Model B. subtilis interactions with host organisms

    • Explore potential biotechnological applications based on manipulating ykoW pathways

    • Develop biosensors using ykoW-based detection systems

    • Investigate antimicrobial resistance connections to ykoW signaling networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.