Recombinant Bacillus subtilis Small basic protein (sbp)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
sbp; BSU15270; Small basic protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
sbp
Target Protein Sequence
MWLPVLGLVLGIAIGLMTNLTIPSEYSNYLSLAVLAALDTLIGGIRAHLQGTYDEMVFVS GFFFNIILAISLAFLGVHLGVDLYLAGIFAFGVRLFQNIAVIRRNLLTKWTLSKKNKKNV I
Uniprot No.

Target Background

Database Links
Protein Families
Sbp family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Small basic protein (Sbp) and what are its key structural characteristics?

Small basic protein (Sbp) is an 18 kDa scaffold protein first identified in Staphylococcus epidermidis, where it functions as a critical component of the extracellular matrix promoting bacterial biofilm formation. Structural analysis reveals:

  • Contains an N-terminal export signal with a putative cleavage site between amino acids 28 and 29

  • Lacks additional conserved motifs such as a covalent cell wall linkage (e.g., LPXTG motif)

  • Functions primarily as an extracellular protein that accumulates on the bacterial cell surface

  • Forms specific interactions with accumulation-associated protein (Aap) domain-B

Bioinformatic tools including SignalP can be used to identify the export signal, while structural motif analysis can be performed using databases like Prosite . The absence of a covalent cell wall anchor suggests Sbp associates with the cell surface through protein-protein interactions rather than covalent linkage.

Why would researchers choose Bacillus subtilis as an expression system for recombinant Sbp?

B. subtilis offers several advantages as an expression system for recombinant Sbp:

  • Highly tractable genetic system with well-characterized genome

  • Natural competence for DNA uptake, facilitating genetic manipulation

  • Efficient secretion of extracellular proteins

  • GRAS (Generally Recognized As Safe) status

  • Absence of endotoxins that complicate purification from Gram-negative systems

  • Rapid growth rate and straightforward cultivation requirements

  • Availability of numerous genetic tools including integration vectors, expression plasmids, and genome editing technologies

B. subtilis is the prototypical Gram-positive bacterium and recent studies have elucidated multiple aspects of its protein transport systems, making it an ideal platform for expressing and studying bacterial surface proteins .

What genetic manipulation techniques are most effective for creating recombinant B. subtilis expressing Sbp?

Several approaches can be used to generate recombinant B. subtilis strains expressing Sbp:

Traditional Allelic Exchange:

  • Design a construct with the Sbp gene flanked by ~500 bp homology regions

  • Transform competent B. subtilis cells using standard competence protocols

  • Select transformants using appropriate antibiotic markers

  • Verify integration by PCR and expression by Western blotting

Integration at Ectopic Loci:

  • The non-essential amyE (starch utilization) or lacA (β-galactosidase) genes are frequently used integration sites

  • Specialized integration vectors are available from the Bacillus Genetic Stock Center

  • Integration at these loci allows stable expression without disrupting essential functions

CRISPR/Cas9-Based Editing:

  • Design proto-spacers adjacent to PAM sequences (NGG in B. subtilis)

  • Construct editing plasmids containing CRISPR/Cas9 components and editing templates

  • Transform, cure the plasmid at 45°C, and verify modifications

The method selection depends on research goals, with CRISPR/Cas9 offering higher efficiency (80-100% positive clones) and leaving no antibiotic cassettes in the final strain .

How can successful expression of recombinant Sbp be verified?

Verification of recombinant Sbp expression requires multiple complementary approaches:

Protein Detection:

  • Western blotting using polyclonal antibodies against Sbp

  • Analysis of cell wall-associated protein fractions, where Sbp typically accumulates

  • Limited examination of culture supernatants (though Sbp is primarily cell-associated)

  • Mass spectrometry for protein identification and characterization

Expression Monitoring:

  • Assess expression at different growth phases (4, 6, 8, 12, and 24 hours)

  • Normalize for cell densities to account for growth differences

  • Compare with known controls (e.g., SarA or Agr regulon mutants)

Functional Verification:

  • Surface adherence assays comparing wild-type and recombinant strains

  • Fluorescence-based quantification of surface-retained cells after washing

Based on studies in S. epidermidis, Sbp expression shows minimal growth phase dependency, so consistent detection across time points would be expected .

What conditions optimize recombinant Sbp production in B. subtilis?

Optimal production requires systematic optimization of multiple parameters:

ParameterRecommendationRationale
Growth mediumMinimal medium followed by rich mediumMimics conditions used in S. epidermidis studies
Temperature30-37°CHigher temperatures may increase proteolysis
Growth phaseLate exponential to early stationaryBalances cell density with protein production
Regulatory factorsConsider SarA homologsSbp production in S. epidermidis is SarA-dependent
Strain backgroundProtease-deficient strainsReduces degradation of secreted proteins
Secretion signalsTest both native and B. subtilis signalsOptimizes secretion efficiency
Zinc supplementation10 μM ZnCl₂Enhances Sbp-protein interactions

Of particular importance is the consideration of zinc supplementation, as studies have shown that Sbp-protein interactions are zinc-dependent, with maximum binding occurring at 10 μM ZnCl₂, corresponding to zinc concentrations in human plasma .

How does Sbp interact with the extracellular matrix in biofilm formation?

Sbp plays a critical role in biofilm formation through several mechanisms:

  • Initial Surface Adherence: While Sbp isn't necessary for primary attachment during very early surface colonization, its accumulation at the bacterium-substrate interface becomes crucial for sustained adherence.

  • Threshold-Dependent Activity: Experimental evidence indicates a critical Sbp threshold quantity determines its pro-adherent effect. Quantitative studies show significantly more bacteria remain surface-adherent when Sbp is present (mean surface adherent CFU = 1.4×10⁷) compared to Sbp-negative strains (mean surface adherent CFU = 8.5×10⁵).

  • Protein-Protein Interactions: Sbp interacts with Aap domain-B, a zinc-binding protein. This interaction is enhanced by zinc, with maximum binding reached at 10 μM ZnCl₂. Importantly, this effect is specific to zinc, as magnesium (MgCl₂) has no impact on Sbp-Aap domain-B interactions.

  • Bacterial Cell Surface Recruitment: Expression of Aap domain-B promotes recruitment of Sbp to the bacterial cell surface, creating a reinforcing mechanism for biofilm stability.

When designing experiments to study these interactions in recombinant systems, researchers should consider time-dependent accumulation of Sbp, as significant increases in Sbp abundance are typically detected after 24 hours of incubation .

How can CRISPR/Cas9 technology be applied to optimize Sbp expression in B. subtilis?

CRISPR/Cas9 offers powerful approaches for engineering optimal Sbp expression:

Step-by-Step Protocol:

  • Plasmid Construction:

    • Digest pPB41 or pPB105 with BsaI

    • Construct phosphorylated proto-spacer for insertion

    • Ligate and transform E. coli

    • Isolate plasmid

  • Creating Editing Plasmid:

    • Linearize pPB41 using Q5 DNA polymerase

    • Amplify CRISPR/Cas9 components

    • Amplify editing template

    • Assemble using Gibson Assembly

  • B. subtilis Transformation:

    • Transform competent B. subtilis (200-600 ng DNA)

    • Plate on LB+spectinomycin, incubate at 30°C

    • Restreak for purity

  • Plasmid Curing:

    • Restreak on LB, incubate at 45°C

    • Confirm plasmid loss (no growth on LB+spec)

    • Verify genetic modifications by PCR

This method can be used to introduce precise modifications without leaving antibiotic cassettes or vector DNA remnants. Potential applications include:

  • Fine-tuning promoter strength

  • Optimizing the signal sequence

  • Modifying chromosomal integration sites

  • Deleting proteases that might degrade Sbp

  • Engineering co-expression of interacting partners

The efficiency of this approach (80-100% positive clones) makes it particularly valuable for complex genetic engineering tasks .

What challenges may arise when expressing staphylococcal Sbp in B. subtilis?

Several challenges must be addressed when expressing Sbp in a heterologous host:

Structural Considerations:

  • Codon usage differences between S. epidermidis and B. subtilis

  • Signal sequence recognition efficiency

  • Protein folding in a different cellular environment

  • Post-translational modifications

Functional Challenges:

  • Different cell wall composition affecting Sbp localization

  • Absence of natural Sbp interaction partners (e.g., Aap domain-B)

  • Different extracellular proteome potentially affecting stability

Regulatory Differences:

  • In S. epidermidis, Sbp production is SarA-dependent but RNAIII-independent

  • B. subtilis may lack comparable regulatory networks

Experimental Approaches to Address Challenges:

  • Perform codon optimization for B. subtilis

  • Test multiple signal sequences

  • Co-express known interaction partners

  • Use protease-deficient B. subtilis strains

  • Engineer regulatory elements optimized for B. subtilis

When troubleshooting expression issues, researchers should collect both cell wall protein fractions and concentrated culture supernatants, as native Sbp primarily associates with the cell surface with only minor amounts shed into the supernatant .

How can the zinc-dependent properties of Sbp be studied in recombinant systems?

Zinc plays a critical role in Sbp function, particularly in protein-protein interactions:

Experimental Approaches:

  • Solid-phase Binding Assays:

    • Immobilize rDomain-B to polystyrene surfaces

    • Test binding of soluble rSbp at varying ZnCl₂ concentrations

    • Include MgCl₂ controls to verify specificity

    • Use competition experiments with pre-incubation of rSbp and soluble rDomain-B

  • Quantitative Analysis:

    • Perform dose-response curves from 0-100 μM ZnCl₂

    • Compare with physiologically relevant concentrations (10 μM)

    • Measure binding parameters (affinity, kinetics)

  • Structural Studies:

    • Analyze zinc-induced conformational changes

    • Identify zinc-binding residues through mutagenesis

    • Compare with other zinc-binding proteins

Key Experimental Finding:
Studies with native Sbp demonstrated that while binding occurred in the absence of zinc, there was a clear, dose-dependent increase when ZnCl₂ was added. Maximum binding was reached at 10 μM ZnCl₂, corresponding to zinc concentrations in human plasma. Importantly, MgCl₂ had no impact on these interactions, suggesting the effect is specific to zinc rather than a general property of divalent cations .

How can researchers study the functional properties of recombinant Sbp in biofilm development?

Multiple methodological approaches can be employed:

Quantitative Adherence Assays:

  • Grow recombinant B. subtilis strains expressing GFP for 24 hours

  • Apply rigorous washing to remove non-adherent cells

  • Quantify remaining fluorescence to determine adherent cell numbers

  • Compare Sbp-expressing and Sbp-negative strains

Time-Course Analysis:

  • Examine Sbp accumulation at different time points (4, 6, 8, 12, and 24 hours)

  • Correlate Sbp levels with adherence properties

  • Determine the critical threshold for functional effects

Surface Modification Studies:

  • Pre-coat surfaces with purified recombinant Sbp

  • Test its ability to promote adhesion of Sbp-negative strains

  • Analyze dose-dependent effects

Confocal Laser Scanning Microscopy:

  • Visualize biofilm architecture in real-time

  • Compare structural differences between wild-type and modified strains

  • Quantify biofilm parameters (thickness, biomass, roughness)

Previous studies with S. epidermidis demonstrated that when surfaces were pre-coated with recombinant Sbp, not only was the adherence defect of Sbp-negative strains restored, but adherent cell numbers of Sbp-positive strains were also increased (mean surface adherent CFU = 2.2×10⁷) .

What protein engineering approaches can enhance recombinant Sbp functionality?

Several protein engineering strategies can optimize recombinant Sbp:

Domain Engineering:

  • Identify and enhance functional domains

  • Create chimeric proteins combining Sbp with B. subtilis-native components

  • Optimize linker regions between functional domains

Stability Engineering:

  • Introduce stabilizing mutations to enhance half-life

  • Remove protease recognition sites

  • Engineer disulfide bonds to improve structural stability

Interaction Engineering:

  • Enhance zinc-binding properties

  • Optimize interfaces with potential B. subtilis interaction partners

  • Create stronger surface-binding variants

Fusion Proteins:

  • Sbp-reporter fusions for easier detection and quantification

  • Sbp-affinity tag fusions for simplified purification

  • Dual-function fusions combining Sbp with complementary biofilm proteins

When engineering Sbp variants, researchers should consider the critical role of the N-terminal export signal and ensure modifications don't disrupt proper secretion and localization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.