Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yomJ (yomJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure the contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
yomJ; BSU21340; SPbeta prophage-derived uncharacterized membrane protein YomJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yomJ
Target Protein Sequence
MGYKFMAYGGYFLFCLFFLLMDGWRGMGICLIIVGLALLALEPYKIKAQKNIDKLKENAE TLKHFDGGFNPDNFFNTYKTKIAFKESDSLVKIYQLNKDEHIEEYTIPFSNVIESEIALD NQIISKVSKSGIVAGGLLAGGIGAAIGGLSASSIQNEMVKSVTLKITVEDLGKPIHYIDF LPTQEVEGYNIQGYKKDSNVIQQALTNAEYWHGVMDVIIKKANKVAQ
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the yomJ protein and what is its origin?

The yomJ protein is an uncharacterized membrane protein derived from the SPBc2 prophage of Bacillus subtilis. This protein belongs to a class of prophage-derived proteins, similar to other proteins like yokF (an endonuclease) that originate from the same prophage region . Prophage-derived proteins are encoded by bacterial DNA that originated from bacteriophages that integrated into the bacterial genome during past infection events.

The functional characterization of yomJ remains limited, placing it among numerous uncharacterized proteins in B. subtilis. Unlike some other B. subtilis proteins that have been systematically studied for essentiality (such as yacA, ydiB, ydiC, ykqC, and others mentioned in functional analysis studies), yomJ has not been extensively characterized regarding its role in bacterial viability or specific cellular functions .

What expression systems are available for recombinant yomJ production?

Multiple expression systems are available for the recombinant production of yomJ protein, each with specific advantages depending on your research needs:

Expression SystemAdvantagesBest Used For
E. coliRapid growth, high yields, cost-effectiveInitial characterization, antibody production
YeastPost-translational modifications, higher eukaryotic compatibilityFunctional studies requiring folding assistance
Mammalian cell linesComplex PTMs, native-like folding for membrane proteinsInteraction studies, structural analysis
Insect cellsHigh expression of complex proteins, moderate PTMsStructural biology applications

The selection of an expression system should be determined by your specific experimental requirements. For membrane proteins like yomJ, insect cell and mammalian expression systems often provide better membrane integration and folding than prokaryotic systems .

What fusion tags should I consider for recombinant yomJ purification?

Various fusion tags can be employed for the efficient purification and detection of recombinant yomJ protein:

Tag TypeSizeAdvantagesPurification Method
His Tag6-10 aaSmall size, minimal interference, economicalImmobilized metal affinity chromatography
FLAG Tag8 aaHigh specificity, good for detectionImmunoaffinity chromatography
MBP42 kDaEnhances solubility, expressionAmylose resin affinity
GST26 kDaGood solubility enhancement, simple detectionGlutathione affinity
GFP27 kDaDirect visualization, folding indicatorSize exclusion, His-tag tandem

How can I assess the quality of purified recombinant yomJ?

Quality assessment of purified recombinant yomJ should involve multiple complementary approaches:

  • Purity Analysis: SDS-PAGE with Coomassie staining to visualize protein bands and determine if the target protein is the predominant species. Western blotting using tag-specific or yomJ-specific antibodies can confirm identity.

  • Homogeneity Assessment: Size exclusion chromatography to evaluate aggregation state and homogeneity of the preparation. Dynamic light scattering can provide additional information on size distribution.

  • Functional Integrity: Circular dichroism spectroscopy to assess secondary structure composition. For membrane proteins like yomJ, reconstitution into liposomes followed by functional assays (if known) or binding studies can verify proper folding.

  • Mass Spectrometry: To confirm protein identity, exact mass, and potential post-translational modifications.

Suppliers typically provide recombinant proteins with defined purity levels (>80%, >90%, >95%), but independent verification is recommended for critical research applications .

How can I determine if yomJ is essential for Bacillus subtilis viability?

Determining the essentiality of yomJ requires systematic approaches similar to those used for other B. subtilis genes:

  • Targeted Gene Inactivation:

    • Construct a deletion strain where the chromosomal copy of yomJ is replaced with an antibiotic resistance marker.

    • If deletion strains cannot be obtained despite multiple attempts under various conditions, this suggests essentiality.

    • Confirm by complementation with an inducible copy of yomJ on a plasmid or at a different chromosomal location.

  • Protein Depletion Studies:

    • Place yomJ under an inducible promoter (e.g., Pspac).

    • Remove the inducer and monitor growth and cell morphology over time.

    • Use quantitative Western blotting to correlate protein levels with phenotypic changes.

  • Conditional Mutants:

    • Generate temperature-sensitive alleles of yomJ.

    • Analyze growth at permissive versus non-permissive temperatures.

This approach has been successfully used to identify other essential genes in B. subtilis. For instance, systematic gene inactivation studies have identified 271 indispensable genes for B. subtilis growth, including several uncharacterized genes that were initially annotated with "y" designations .

What experimental approaches can elucidate the subcellular localization of yomJ?

As a membrane protein, determining yomJ's precise subcellular localization is critical for understanding its function:

  • Fluorescent Protein Fusions:

    • Generate C- or N-terminal GFP fusions of yomJ (consider topology predictions to determine optimal fusion site).

    • Express from native promoter at original chromosomal location if possible.

    • Image using fluorescence microscopy to determine localization patterns.

    • Compare to known membrane protein markers (e.g., MinD for cell poles, FtsZ for division sites).

  • Immunofluorescence Microscopy:

    • Generate antibodies against purified yomJ or use epitope tags.

    • Fix and permeabilize cells, then perform immunostaining.

    • Particularly useful if GFP fusions affect function.

  • Membrane Fractionation:

    • Separate cytoplasmic, peripheral membrane, and integral membrane fractions.

    • Detect yomJ using Western blotting.

    • Use treatments like high salt, alkaline pH, or detergents to distinguish peripheral from integral membrane proteins.

  • Co-localization Analysis:

    • Combine with markers for specific membrane domains or with proteins of known function.

    • For prophage-derived proteins, examine co-localization with other prophage components.

This approach yielded valuable insights for YkqC, which was found to co-localize with ribosomes, suggesting a role in processing either rRNA or specific mRNAs when associated with the ribosome .

How can I analyze potential interactions between yomJ and other B. subtilis proteins?

Identifying protein-protein interactions is crucial for elucidating yomJ function:

  • Co-immunoprecipitation (Co-IP):

    • Tag yomJ with an epitope tag (His, FLAG).

    • Crosslink cells if interactions are transient.

    • Lyse cells and immunoprecipitate yomJ.

    • Identify co-precipitating proteins by mass spectrometry.

  • Bacterial Two-Hybrid System:

    • Clone yomJ and potential interaction partners into two-hybrid vectors.

    • Test pairwise interactions in a reporter strain.

    • Screen a B. subtilis genomic library to identify novel interactions.

  • Proximity-Dependent Biotinylation:

    • Fuse yomJ to a biotin ligase (BioID or TurboID).

    • Express in B. subtilis and induce biotinylation.

    • Purify biotinylated proteins and identify by mass spectrometry.

  • Chemical Crosslinking Combined with Mass Spectrometry:

    • Treat intact cells with membrane-permeable crosslinkers.

    • Purify yomJ complexes and analyze by LC-MS/MS.

    • Identify crosslinked peptides to map interaction interfaces.

Focus particularly on interactions with other SPBc2 prophage-derived proteins, as prophage genes often function in modules or pathways. Compare with interaction profiles of characterized prophage proteins like yokF (endonuclease) .

What structural analysis methods are appropriate for membrane proteins like yomJ?

Structural characterization of membrane proteins presents unique challenges:

  • NMR Spectroscopy:

    • Isotopically label yomJ (13C, 15N) for structural determination.

    • Analyze in detergent micelles or lipid nanodiscs.

    • Use HSQC, TOCSY, and NOESY experiments for resonance assignments.

    • Apply CASPER (Computer Assisted Spectrum Evaluation of Regular Polysaccharides) principles for chemical shift prediction and structural validation .

  • X-ray Crystallography:

    • Optimize detergent and lipid conditions for crystal formation.

    • Use lipidic cubic phase crystallization specifically designed for membrane proteins.

    • Consider fusion proteins (e.g., T4 lysozyme) to increase polar surface area.

  • Cryo-Electron Microscopy:

    • Particularly valuable for larger membrane protein complexes.

    • Analyze protein reconstituted in nanodiscs or amphipols.

    • Use single-particle analysis for structure determination.

  • Computational Structure Prediction:

    • Employ AlphaFold2 or RoseTTAFold for initial structural models.

    • Validate predictions with limited experimental data (crosslinking, FRET).

    • Use molecular dynamics simulations to assess stability in membrane environments.

The method selection should consider the size of yomJ, available quantities of purified protein, and desired resolution. For initial characterization, computational modeling coupled with experimental validation may provide the most resource-efficient approach.

How should I design experiments to study the effects of yomJ depletion?

Protein depletion studies require careful experimental design:

  • Genetic System Construction:

    • Replace the native promoter with an inducible system (e.g., Pspac or Pxyl).

    • Alternatively, use a degron-tagged version of yomJ for targeted protein degradation.

    • Verify the construction by sequencing and initial expression testing.

  • Depletion Protocol:

    • Grow cultures with inducer to mid-log phase.

    • Wash cells and transfer to media without inducer.

    • Take samples at regular intervals (every 30 minutes initially, then hourly).

  • Analytical Methods:

    • Growth monitoring (OD600 readings)

    • Microscopy for morphological changes

    • Quantitative Western blotting to confirm protein depletion

    • RNA extraction and RT-qPCR for transcriptional effects

    • Physiological assays specific to membrane function

  • Experimental Design Considerations:

    • Include positive controls (depletion of known essential proteins)

    • Include negative controls (depletion of non-essential proteins)

    • Perform biological replicates (minimum n=3)

    • Consider Latin Square design for multiple variables

A systematic approach similar to that used for other essential B. subtilis genes should be employed, with careful documentation of all protocols and results to ensure reproducibility .

What statistical approaches are appropriate for analyzing yomJ depletion phenotype data?

Proper statistical analysis is crucial for interpreting depletion experiments:

  • Growth Curve Analysis:

    • Use repeated measures ANOVA for time-course data.

    • Calculate doubling times and compare using t-tests or non-parametric alternatives.

    • Apply growth models to extract parameters (lag phase, max growth rate).

  • Morphological Data Analysis:

    • Quantify cell dimensions from microscopy images (length, width).

    • Use distribution analysis rather than simple means.

    • Apply chi-square tests for morphological categories.

  • Experimental Design Considerations:

    • Implement factorial designs when multiple variables are involved.

    • Consider Resolution 4 designs that allow main effects to be estimated independently of two-factor interactions .

    • Run pilot experiments to establish variability and required sample sizes.

  • Data Visualization:

    • Create time-resolved heat maps for multiple parameters.

    • Use principal component analysis for multidimensional data.

    • Generate box-and-whisker plots to show data distributions.

When designing complex experiments, consultation with a statistician during the planning phase is highly recommended to ensure appropriate statistical power and valid inference drawing .

How can I optimize codon usage for maximum expression of recombinant yomJ?

Codon optimization is critical for heterologous expression of B. subtilis proteins:

  • Codon Usage Analysis:

    • Calculate the Codon Adaptation Index (CAI) of native yomJ sequence.

    • Compare codon frequency in yomJ with the expression host's preferred codons.

    • Identify rare codons that might cause translational pausing.

  • Optimization Strategy:

    • Replace rare codons with synonymous codons common in the expression host.

    • Avoid introducing or removing regulatory elements or secondary structures.

    • Consider optimizing for translation initiation efficiency by modifying the 5' region.

  • Experimental Validation:

    • Compare expression levels between native and optimized sequences.

    • Analyze protein solubility and activity to ensure proper folding.

    • Consider testing multiple optimization algorithms if results are suboptimal.

Several service providers offer guaranteed recombinant protein expression packages that include codon optimization, gene synthesis, subcloning, and protein expression/purification . These services often guarantee success rates exceeding 95% across various expression systems.

What experimental approaches can determine if yomJ is involved in lipid synthesis or cell wall synthesis?

Based on studies of other essential B. subtilis proteins, yomJ might be involved in key cellular processes like lipid or cell wall synthesis :

  • Lipid Synthesis Analysis:

    • Monitor phospholipid composition changes during yomJ depletion using thin-layer chromatography or mass spectrometry.

    • Pulse-chase experiments with radiolabeled fatty acid precursors.

    • Measure membrane fluidity changes using fluorescence anisotropy.

    • Test genetic interactions with known lipid synthesis genes.

  • Cell Wall Synthesis Investigation:

    • Analyze peptidoglycan composition during depletion using HPLC.

    • Monitor sensitivity to cell wall-targeting antibiotics.

    • Visualize cell wall synthesis using fluorescent D-amino acids.

    • Examine localization with respect to cell wall synthesis machinery.

  • Genetic Approach:

    • Construct conditional mutants combined with mutations in known pathways.

    • Perform suppressor screens to identify genes that can compensate for yomJ deficiency.

    • Test for synthetic lethality with non-essential genes in relevant pathways.

  • Biochemical Characterization:

    • Develop in vitro assays with purified yomJ and potential substrates.

    • Test binding to lipid membranes of various compositions.

    • Analyze protein-protein interactions with enzymes involved in these pathways.

These approaches have been successful in defining functions for other previously uncharacterized essential proteins in B. subtilis, revealing their roles in fundamental cellular processes .

How should contradictory localization data for yomJ be interpreted?

Contradictory localization data is common for membrane proteins and requires careful interpretation:

  • Methodological Analysis:

    • Compare the specific methods used (GFP fusion vs. immunofluorescence).

    • Assess whether tag position could influence localization (N- vs. C-terminal).

    • Evaluate expression levels (overexpression can cause mislocalization).

    • Determine if fixation methods might alter membrane protein localization.

  • Biological Interpretation:

    • Consider if localization is dynamic (changes with cell cycle or stress).

    • Assess if the protein might have multiple populations with distinct localizations.

    • Evaluate whether interaction partners influence localization.

  • Resolution Strategies:

    • Perform time-lapse microscopy to capture dynamic behavior.

    • Use split-fluorescent protein complementation to validate interaction-dependent localization.

    • Apply super-resolution microscopy for more precise localization.

    • Perform biochemical fractionation to complement microscopy data.

  • Documentation Practices:

    • Clearly document all experimental conditions.

    • Use standardized imaging and analysis protocols.

    • Quantify localization patterns across large cell populations.

Comparing your findings with localization patterns of other prophage-derived proteins may provide additional context for interpretation.

How can comparative genomics provide insights into yomJ function?

Comparative genomic approaches can reveal valuable functional insights:

  • Sequence Conservation Analysis:

    • Compare yomJ sequences across Bacillus species and related genera.

    • Identify highly conserved residues or domains likely critical for function.

    • Map conservation onto predicted structural models to identify functional surfaces.

  • Genomic Context Analysis:

    • Examine gene neighborhood conservation (synteny) across species.

    • Identify co-occurrence patterns with functionally characterized genes.

    • Analyze operon structures containing yomJ homologs.

  • Evolutionary Analysis:

    • Construct phylogenetic trees of yomJ homologs.

    • Compare with species phylogeny to identify horizontal gene transfer events.

    • Calculate selection pressures (dN/dS ratios) to identify constraints.

  • Prophage Integration Analysis:

    • Compare with other prophage elements in diverse bacterial genomes.

    • Identify if yomJ is part of a conserved prophage module.

    • Determine if yomJ has homologs in free-living phages.

This approach can be particularly valuable for prophage-derived proteins, as it may reveal whether yomJ represents a domesticated phage function that has been repurposed for bacterial cellular processes.

How can NMR spectroscopy data for yomJ be analyzed and interpreted?

NMR spectroscopy provides valuable structural information for membrane proteins like yomJ:

  • Experimental Design:

    • Select appropriate membrane mimetics (detergents, bicelles, nanodiscs).

    • Optimize sample conditions (temperature, pH, ionic strength).

    • Design labeled samples (15N, 13C, 2H) for different experiments.

  • Data Collection and Processing:

    • Collect 1D 1H and 13C NMR spectra as baseline data.

    • Perform 2D experiments: HSQC for backbone assignments; TOCSY for identifying spin systems.

    • Implement H2BC experiments for intraresidue correlations.

    • Use HMBC experiments for three-bond correlations, valuable for sequential assignments .

  • Data Analysis Approach:

    • Apply CASPER methodology for chemical shift prediction and validation.

    • Use automated and manual assignment strategies in tandem.

    • Compare experimental shifts with predicted values from structural models.

    • Identify secondary structure elements from chemical shift indices.

  • Interpretation Frameworks:

    • Combine NMR data with computational models.

    • Integrate with molecular dynamics simulations in membrane environments.

    • Correlate structural elements with evolutionary conservation data.

The CASPER approach, while developed for carbohydrates, demonstrates how chemical shift prediction can aid structural analysis, and similar principles can be applied to protein NMR data interpretation .

What considerations are important when designing a central composite experimental design for yomJ functional studies?

Complex experimental designs are valuable for efficiently exploring multiple variables in yomJ characterization:

  • Factorial Design Considerations:

    • Identify key variables affecting yomJ function or expression.

    • Determine appropriate ranges for each variable based on pilot studies.

    • Consider using a Resolution 4 design where main effects can be estimated independently of two-factor interactions .

  • Central Composite Design Implementation:

    • Add center points to assess variability and detect non-linearity.

    • Include star points to estimate curvature effects.

    • Consider constraints that might limit feasible combinations.

  • Practical Implementation:

    • Account for operational constraints (e.g., temperature can be readily increased but not decreased) .

    • Consider temporal restrictions (e.g., experiments requiring extensive reassembly).

    • Plan for pilot runs to validate the experimental setup.

  • Analysis Strategy:

    • Use response surface methodology to model complex relationships.

    • Implement staged experimental approaches with analysis between stages.

    • Consider revising experimental designs based on preliminary results rather than rigidly following pre-defined plans .

Central composite designs are particularly valuable when optimization of expression or purification conditions is needed, allowing efficient exploration of multiple variables while maintaining statistical power.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.