Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosE (yosE)

Shipped with Ice Packs
In Stock

Description

Protein Identity and Classification

The yosE protein is identified by its UniProt accession number O31884 and is classified as a membrane protein derived from a prophage sequence present in Bacillus subtilis strain 168 . Prophages are viral DNA segments integrated into bacterial genomes that may remain dormant or occasionally become activated. The protein is specifically designated as being derived from the SPBc2 prophage, indicating its origin from one of the prophage elements found within the B. subtilis genome .

Physical and Chemical Properties

The commercially available recombinant yosE protein is typically produced as a partial protein rather than the full-length version, suggesting potential challenges in expressing the complete protein . While specific details regarding the molecular weight, isoelectric point, and complete amino acid sequence are not extensively documented in the available literature, commercial preparations of the protein demonstrate a purity level exceeding 85% when analyzed by SDS-PAGE . This level of purity is considered sufficient for most research applications, including immunological studies and protein-protein interaction analyses.

Recombinant Production Systems

The recombinant yosE protein is primarily produced in Escherichia coli expression systems, which is a standard approach for bacterial protein production . This heterologous expression system allows for controlled production of the protein in laboratory settings. The use of E. coli rather than the native B. subtilis for production suggests that there may be technical advantages to using this alternative host, possibly related to expression efficiency or protein folding considerations.

Reconstitution Protocol

For laboratory use, the lyophilized form of recombinant yosE protein requires proper reconstitution to maintain its structural integrity and functional properties. The recommended protocol involves centrifugation of the vial prior to opening to ensure the protein content is collected at the bottom of the container . Reconstitution should be performed using deionized sterile water to achieve a final concentration between 0.1-1.0 mg/mL . For long-term storage following reconstitution, the addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the standard concentration suggested by manufacturers . This glycerol addition serves as a cryoprotectant to prevent damage during freeze-thaw cycles.

Bacillus subtilis as a Model Organism

Bacillus subtilis serves as a significant model organism in microbiological research and has various applications in both academic and industrial settings. It is a Gram-positive, aerobic spore-forming bacterium commonly found in soil environments . The bacterium has been extensively studied as a model system for understanding bacterial physiology, genetics, and developmental processes such as sporulation. Notably, B. subtilis has also found application in oral bacteriotherapy and bacterioprophylaxis for gastrointestinal disorders in humans and animals .

The use of B. subtilis as a probiotic represents an interesting scientific question given its primary nature as an aerobic saprophyte, which contrasts with typical anaerobic gut probiotics like Lactobacillus species . The potential health benefits of B. subtilis spores when administered orally remain an area of ongoing investigation, with questions surrounding whether these spores germinate and colonize the gut, competitively exclude pathogenic organisms, or provide unique stimuli to the gut microbiota .

Prophage Elements in Bacterial Genomes

Prophages represent integrated viral genomes within bacterial chromosomes that remain dormant until specific environmental or cellular conditions trigger their activation. The SPBc2 prophage found in B. subtilis strain 168 is one such genetic element that contains numerous genes encoding proteins with diverse, and often uncharacterized, functions. The presence of prophage elements can significantly influence bacterial phenotypes, including virulence, stress resistance, and metabolic capabilities.

Strain Verification and Authentication

Research involving B. subtilis and its derived proteins requires careful attention to strain authentication. Previous studies have identified issues with commercial B. subtilis preparations, where biochemical, physiological, and phylogenetic analyses revealed mislabeling of products . For instance, some commercial preparations labeled as B. subtilis were found to contain unrelated Bacillus species, highlighting the importance of proper taxonomic verification when working with these organisms and their derived proteins .

Technical Approaches to Studying Membrane Proteins

Membrane proteins like yosE present unique challenges for structural and functional characterization. Standard approaches for investigating such proteins include:

  1. Detergent-based extraction and purification

  2. Reconstitution into artificial membrane systems

  3. Fluorescent tagging for localization studies

  4. Cryo-electron microscopy for structural determination

  5. Mass spectrometry for interaction studies

These methodologies must be carefully adapted when working with uncharacterized proteins like yosE to generate meaningful data while maintaining the protein's native properties.

Challenges in Characterizing Uncharacterized Proteins

The "uncharacterized" designation of yosE highlights the current knowledge gap regarding this protein's function and biological significance. This uncharacterized status may result from various factors, including:

  1. Technical challenges in working with membrane proteins

  2. Limited expression under standard laboratory conditions

  3. Absence of obvious phenotypes in deletion mutants

  4. Redundancy in function with other proteins

  5. Expression only under specific, possibly unidentified, conditions

Future Research Directions

Future research efforts to characterize yosE might benefit from considering the following approaches:

  1. Comparative genomics across different Bacillus species to identify conserved domains or motifs

  2. Transcriptomic analysis under various stress conditions to identify expression patterns

  3. Creation of targeted deletion mutants and assessment of phenotypic changes

  4. Proteomic approaches to identify interaction partners

  5. Advanced structural biology techniques to determine three-dimensional configuration

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us and we will prioritize development of the specified tag.
Synonyms
yosE; BSU20150; SPbeta prophage-derived uncharacterized membrane protein YosE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yosE
Target Protein Sequence
MNKDTKDIWSGFFMGSGSLIVVGLLIFVEALTMSLIVYYGLNHVLNPLLIDTYNIQNVHV TLPHAFVIGVLLNVFVKGVKRSDQEKDENIFKKAGKSLFHSTFALIVLYVSTLFI
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the yosE membrane protein and what is its origin?

The yosE protein is classified as an uncharacterized membrane protein derived from the SPBc2 prophage in Bacillus subtilis. It is encoded within the genome of B. subtilis strain 168 and has been assigned the UniProt accession number O31884 . As a prophage-derived protein, yosE originates from bacteriophage genetic material that has been integrated into the bacterial chromosome. Prophages like SPBc2 can contribute significantly to bacterial phenotypes and often encode membrane proteins that may participate in various cellular processes .

To study yosE's origin experimentally, researchers should consider:

  • Comparative genomic analysis with other Bacillus strains to assess conservation

  • Phylogenetic analysis to trace evolutionary relationships with similar prophage proteins

  • Transcriptional analysis to determine if yosE expression is linked to prophage induction

What expression systems are most effective for producing recombinant yosE protein?

E. coli expression systems have been successfully employed for the recombinant production of yosE protein . When designing expression systems for membrane proteins like yosE, researchers should consider:

  • Vector selection: The pHT43 shuttle vector has been effectively used for expressing recombinant proteins in B. subtilis systems, as demonstrated in similar studies .

  • Induction conditions: IPTG (0.1M) induction when bacterial growth reaches OD600 = 0.5, followed by 3 additional hours of culture .

  • Protein extraction: Ultrasonication methods for cell lysis followed by appropriate membrane protein solubilization .

  • Purification strategy: Affinity chromatography utilizing appropriate tags that can be incorporated during recombinant design.

For optimal expression, researchers should test multiple expression systems and conditions, as membrane proteins often present challenges during heterologous expression.

What are the recommended storage and handling procedures for recombinant yosE protein?

For optimal stability and functionality of recombinant yosE protein:

  • Reconstitution: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Glycerol addition: Add 5-50% glycerol (final concentration) for long-term storage, with 50% being the default recommendation .

  • Storage temperature: Store at -20°C/-80°C for longest shelf life .

  • Aliquoting: Prepare working aliquots to avoid repeated freeze-thaw cycles.

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week .

  • Shelf life: Liquid form has approximately 6 months shelf life at -20°C/-80°C, while lyophilized form maintains stability for approximately 12 months .

Researchers should validate protein activity after extended storage periods, particularly for functional assays.

What experimental approaches can be used to determine the structure of yosE protein?

For structural characterization of yosE, researchers should consider a multi-technique approach:

Given that yosE is an uncharacterized membrane protein, researchers should first optimize detergent conditions for extraction and purification while maintaining native conformation before attempting structural studies.

What functional roles might yosE play in prophage biology and bacterial physiology?

While specific functions of yosE remain uncharacterized, research on similar prophage-derived membrane proteins suggests several potential roles:

  • Membrane vesicle (MV) formation: Prophage proteins can contribute to MV biogenesis in bacteria like B. subtilis. These MVs may contain prophage proteins and participate in intercellular communication .

  • Lysis regulation: Some prophage membrane proteins participate in host cell lysis through holin-endolysin systems. For example, in B. subtilis, prophage-encoded membrane proteins can create perforations in bacterial walls leading to vesicle formation rather than explosive cell lysis .

  • Immune modulation: Recombinant B. subtilis strains expressing prophage-derived proteins have demonstrated immunomodulatory properties, suggesting potential roles in host-bacteria interactions .

To experimentally characterize yosE function, researchers should consider:

  • Gene knockout studies to observe phenotypic changes

  • Protein-protein interaction studies to identify binding partners

  • Localization studies to determine subcellular distribution

  • Comparative analysis with characterized prophage membrane proteins

How can researchers distinguish between yosE and other prophage-derived membrane proteins in functional studies?

To specifically study yosE among other prophage-derived proteins:

  • Generate specific antibodies: Develop antibodies against unique epitopes of yosE for immunoblotting, immunoprecipitation, and immunofluorescence microscopy.

  • Tagged protein expression: Create recombinant fusion proteins with RFP or other fluorescent tags for tracking, similar to the approach used for other B. subtilis recombinant proteins .

  • Mass spectrometry identification: Use targeted proteomics to distinguish yosE from other membrane proteins in complex samples.

  • Sequence-specific nucleic acid probes: Develop probes targeting the yosE gene for expression analysis.

  • Comparative analysis: Study yosE across different B. subtilis strains or growth conditions to identify strain-specific or condition-dependent behaviors.

These approaches allow researchers to specifically track and characterize yosE in the context of the broader bacterial and prophage proteome.

How might yosE contribute to membrane vesicle formation in B. subtilis?

Recent research has demonstrated that prophage proteins play important roles in membrane vesicle (MV) formation in Gram-positive bacteria including B. subtilis . For investigating yosE's potential role in MV formation:

  • Quantitative comparison of MV production: Compare MV production between wild-type B. subtilis and yosE knockout or overexpression strains.

  • Proteomics analysis: Determine if yosE is present in the MV fraction, as studies have shown that prophage proteins can be enriched in bacterial MVs .

  • Electron microscopy: Analyze MV morphology and size distribution (typically 50-100 nm) in relation to yosE expression levels .

  • Induction studies: Examine whether genotoxic stress (e.g., mitomycin C treatment) that triggers prophage induction affects yosE expression and subsequent MV production .

  • Prophage excision analysis: Use qPCR approaches to determine if yosE expression correlates with prophage excision or replication events, similar to methods used for studying PLE2 prophage in L. casei .

This systematic approach would help determine whether yosE functions similarly to other prophage membrane proteins that contribute to the "bubbling cell death" phenomenon observed in some bacteria.

What challenges arise when studying uncharacterized membrane proteins like yosE, and how can they be addressed?

Studying uncharacterized membrane proteins presents several specific challenges:

ChallengeDescriptionMitigation Strategy
Protein SolubilizationMembrane proteins require detergents for extraction and purificationScreen multiple detergents; consider nanodiscs or amphipols for stabilization
Low Expression LevelsMembrane proteins often express poorly in heterologous systemsOptimize codon usage; use specialized expression strains; test multiple promoters
Protein InstabilityMembrane proteins may misfold or aggregate outside native membrane environmentInclude stabilizing agents; utilize fusion partners; maintain low temperatures
Functional AssaysDifficult to assess function without known activityDevelop binding assays; screen for phenotypic changes in knockout strains; use comparative genomics
CrystallizationMembrane proteins are notoriously difficult to crystallizeTry lipidic cubic phase methods; consider alternative structural techniques like cryo-EM

For yosE specifically, researchers should consider specialized approaches such as developing a B. subtilis-based expression system that might better maintain the native conformation of this prophage-derived protein.

How can transcriptomic and proteomic approaches be integrated to understand yosE regulation and function?

For comprehensive characterization of yosE regulation and function:

  • RNA-Seq analysis: Identify conditions that induce yosE expression, particularly in response to stress or prophage induction stimuli.

  • ChIP-Seq: Identify transcription factors that regulate yosE expression.

  • Ribosome profiling: Determine translation efficiency of yosE under various conditions.

  • Quantitative proteomics: Measure yosE protein levels and identify post-translational modifications.

  • Interactomics: Use pull-down assays coupled with mass spectrometry to identify protein-protein interactions involving yosE.

  • Integration of datasets: Develop computational models that correlate transcriptomic and proteomic data to predict functional pathways involving yosE.

This multi-omics approach would provide a comprehensive understanding of yosE's place in the bacterial regulatory network and prophage biology.

What potential biotechnological applications might yosE have in vaccine development or protein delivery systems?

Based on research with similar prophage-derived membrane proteins:

  • Mucosal vaccine delivery: B. subtilis expressing recombinant membrane proteins has demonstrated effectiveness as a mucosal vaccine delivery system . YosE could potentially be engineered as a carrier for antigenic determinants.

  • Enhanced immune response: Recombinant B. subtilis strains have shown ability to enhance mucosal secretory IgA and serum IgG production . YosE-based constructs could be tested for similar immunomodulatory properties.

  • Membrane vesicle engineering: If yosE participates in MV formation, engineered yosE variants could be developed to create customized MVs for protein or nucleic acid delivery .

  • M cell targeting: Some B. subtilis recombinant proteins demonstrate enhanced binding to M cells, improving mucosal immunity . YosE could be investigated for similar properties or engineered to include M cell-binding domains.

These applications require thorough characterization of yosE's membrane topology, stability, and potential immunogenicity before practical implementation.

How can yosE be studied in the context of prophage-host interactions and bacterial evolution?

To understand yosE's evolutionary significance and role in prophage-host dynamics:

  • Comparative genomics: Analyze the conservation and variation of yosE across different B. subtilis strains and related species. This can reveal selective pressures and evolutionary trajectories.

  • Prophage induction studies: Determine if yosE expression changes during spontaneous or induced prophage activation, similar to studies showing prophage PLE2 replication in response to environmental conditions .

  • Host response analysis: Investigate how bacterial gene expression changes in response to yosE overexpression or deletion.

  • Horizontal gene transfer: Examine if yosE contributes to genetic exchange between bacterial populations via membrane vesicles.

  • Phage-bacterial co-evolution: Study the relationship between yosE sequence variants and corresponding phage resistance or susceptibility phenotypes.

This evolutionary perspective can provide insights into the functional integration of prophage elements like yosE into bacterial physiology over time.

What are the best practices for confirming the purity and integrity of recombinant yosE preparations?

For quality control of recombinant yosE preparations:

  • SDS-PAGE analysis: Standard for assessing protein purity, with expectation of >85% purity for research applications .

  • Western blotting: Use anti-PEDV antibodies or specific anti-yosE antibodies for verification of protein identity .

  • Mass spectrometry: For definitive identification and detection of potential post-translational modifications.

  • Size exclusion chromatography: To assess aggregation state and quaternary structure.

  • Circular dichroism: To verify proper protein folding through secondary structure analysis.

  • Thermal shift assays: To evaluate protein stability under various buffer conditions.

  • Dynamic light scattering: To check for protein monodispersity and detect aggregation.

These methods collectively ensure that functional studies are conducted with properly folded, non-aggregated protein of confirmed identity.

How can researchers overcome challenges in expressing and purifying sufficient quantities of yosE for structural studies?

To optimize yosE expression and purification for structural studies:

  • Expression system optimization:

    • Test multiple host strains (E. coli C41/C43, specialized membrane protein expression strains)

    • Evaluate different promoters and induction conditions

    • Consider fusion tags that enhance membrane protein expression (MBP, SUMO)

  • Purification strategy:

    • Screen detergent panel for optimal solubilization

    • Implement two-step purification (e.g., affinity followed by size exclusion)

    • Optimize buffer conditions to enhance stability

  • Scale-up considerations:

    • Use fed-batch fermentation to achieve higher cell densities

    • Implement automated purification to maintain consistency

    • Consider nanodiscs or amphipols for detergent-free handling

  • Quality control:

    • Implement thermal stability assays to identify optimal buffer conditions

    • Use small-scale expression tests to rapidly screen conditions

    • Validate protein activity to ensure native conformation is maintained

These approaches can help overcome the typically low yields associated with membrane protein purification for structural studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.