Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosW (yosW)

Shipped with Ice Packs
In Stock

Description

Bacillus subtilis as a Model Organism for Membrane Protein Research

Bacillus subtilis serves as a crucial model organism for studying gram-positive bacteria and their cellular processes. This bacterium contains various membrane proteins involved in essential functions, including protein biogenesis. The available research indicates that B. subtilis contains important membrane protein insertion machinery, including two Oxa1p homologs: SpoIIIJ and YqjG, which play critical roles in membrane protein insertion and assembly . While these proteins are not YosW, understanding their function helps provide context for the potential roles of other membrane proteins in this organism.

The significance of membrane proteins in B. subtilis extends to their involvement in energy-transducing complexes, particularly the F1F0 ATP synthase. Research shows that both SpoIIIJ and YqjG facilitate the insertion of F1F0 ATP synthase components and other membrane proteins . This highlights the sophisticated membrane protein machinery present in B. subtilis, which would likely also affect prophage-derived membrane proteins such as YosW.

Membrane Protein Biogenesis Mechanisms in Bacillus subtilis

Based on the available research, membrane protein biogenesis in B. subtilis involves complex mechanisms similar to those found in other bacteria. SpoIIIJ and YqjG function analogously to YidC in Escherichia coli, mediating protein insertion through both SecYEG-dependent and -independent pathways . These proteins have demonstrated the ability to functionally replace YidC in E. coli, indicating conservation of membrane protein insertion mechanisms across bacterial species .

This conservation suggests that prophage-derived membrane proteins like YosW might utilize similar insertion pathways, although direct evidence for YosW's insertion mechanism is not available in the current literature. The demonstrated versatility of B. subtilis membrane protein insertion machinery would theoretically accommodate diverse membrane proteins, including those of prophage origin.

Prophage-Derived Proteins in Bacterial Systems

While specific information about the SPBc2 prophage and its protein YosW is not detailed in the provided research, prophage-derived proteins generally represent an important category of bacterial proteins with diverse functions. Prophages are viral genomes that have integrated into bacterial chromosomes and can remain dormant for generations while contributing to the host's genetic repertoire.

Prophage-derived proteins frequently serve specialized functions within the bacterial host, potentially including:

  • Membrane transport or signaling

  • Defense against competing bacteria or environmental stressors

  • Regulatory functions affecting host metabolism

  • Structural components in membrane architecture

As an uncharacterized membrane protein derived from the SPBc2 prophage, YosW likely belongs to one of these functional categories, though its precise role remains to be elucidated through targeted research.

Membrane Protein Function and Characterization

The research on B. subtilis membrane proteins provides insights into potential methodologies for studying uncharacterized membrane proteins like YosW. SpoIIIJ and YqjG have been shown to:

  • Facilitate membrane insertion of F1F0 ATP synthase subunit c from both E. coli and B. subtilis

  • Complement YidC function in both SecYEG-dependent and -independent membrane insertion pathways

  • Associate physically with the entire F1F0 ATP synthase complex, suggesting roles beyond simple insertion

  • Support the insertion of respiratory chain components like cytochrome o oxidase

These diverse functions highlight the multifaceted roles membrane proteins can play in bacterial physiology, suggesting that YosW may similarly perform specialized functions related to membrane biology, potentially influenced by its prophage origin.

Potential Functions of Uncharacterized Membrane Proteins

Based on patterns observed in characterized membrane proteins, uncharacterized proteins like YosW might function in:

Potential Function CategoryExample MechanismsRelevance to Prophage-Derived Proteins
Membrane TransportIon or nutrient translocationMay facilitate specialized uptake or export
SignalingTransmembrane signal transductionCould integrate prophage activity with host physiology
StructuralMembrane organization or scaffoldingMight alter membrane properties to benefit prophage
BiogenesisAssisting other protein insertionCould facilitate insertion of other prophage proteins
DefenseAntimicrobial or immunity functionsMay protect host from competing organisms

While the specific function of YosW cannot be determined from the available research, these categories represent plausible roles based on our understanding of membrane proteins and prophage contributions to bacterial physiology.

Research Methodologies for Characterizing Membrane Proteins

The research on B. subtilis membrane proteins demonstrates several methodologies that would be applicable to studying uncharacterized membrane proteins like YosW. These approaches include:

Recombinant Expression Systems

The available research describes expression systems for B. subtilis membrane proteins including:

  • Expression of His-tagged proteins in both E. coli and B. subtilis systems

  • Induction protocols using subtilin for controlled expression

  • Cell disruption and membrane isolation techniques

  • Solubilization and purification protocols for membrane proteins

These methodologies could be adapted for the expression and purification of recombinant YosW, providing material for structural and functional characterization.

Functional Complementation Assays

The research demonstrates how B. subtilis membrane proteins were tested through functional complementation:

  • Expression in YidC-depleted E. coli strains to assess functional replacement

  • Measurement of ATPase and cytochrome o oxidase activities to assess restoration of function

  • Analysis of specific membrane protein insertion to confirm activity

Similar complementation approaches could be employed to investigate YosW by testing its ability to complement the function of other characterized membrane proteins or by assessing phenotypes in YosW deletion strains.

Protein-Protein Interaction Studies

The research reveals that SpoIIIJ and YqjG form complexes with other membrane proteins:

  • Co-purification with the F1F0 ATP synthase complex

  • Evidence for roles in complex assembly beyond initial insertion

Analogous interaction studies could identify YosW binding partners, potentially revealing its functional role in the context of other cellular processes or structures.

In Vitro Analysis Techniques

The research highlights in vitro techniques that could be applied to YosW characterization:

TechniqueApplicationPotential Insights for YosW
Coupled transcription-translation-insertion assaysAssessment of membrane insertion capabilityCould determine if YosW facilitates insertion of other proteins
Proteinase K accessibility assaysDetermination of membrane topologyWould reveal YosW's orientation in the membrane
Reconstitution in liposomesFunctional studies in defined systemsCould assess transport or other biochemical activities
Differential spectroscopyAnalysis of conformational changesMight reveal dynamic aspects of YosW function

These approaches would provide complementary data about YosW's biochemical properties and function.

Computational Approaches for Uncharacterized Proteins

In the absence of experimental data, computational approaches offer valuable preliminary insights into uncharacterized proteins like YosW:

  • Sequence homology analysis to identify related proteins

  • Structural prediction using algorithms trained on known membrane protein structures

  • Identification of conserved domains or motifs indicating potential functions

  • Genomic context analysis examining the prophage region containing yosW

These computational approaches could guide experimental design by generating testable hypotheses about YosW's function.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
yosW; BSU19980; SPbeta prophage-derived uncharacterized membrane protein YosW
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yosW
Target Protein Sequence
MIMRGESNTYIKVKSVLDNSTPEDAKRNKNLIYLFTLLKGSSLIIPLAYNGLIMHENILI LCWTAFSVIYTVLSMFKVLDVLEGETVSHSRYIYLAYVFGNLIFALSIIFHIM
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of yosW in Bacillus subtilis?

The yosW gene (also referred to as hypothetical protein BSU19980) is derived from the SPBc2 prophage integrated into the Bacillus subtilis genome . Prophages are viral DNA sequences that have been incorporated into bacterial chromosomes and often remain dormant until specific conditions trigger their activation. The genomic positioning of yosW within the SPBc2 prophage region suggests it may have been acquired through horizontal gene transfer, which is a common evolutionary mechanism in B. subtilis . The prophage-derived nature of yosW indicates that it may have functions related to phage biology or may have been repurposed by the host bacteria for other cellular processes, making it an interesting target for studying host-phage interactions and genome evolution in B. subtilis.

What expression systems are suitable for producing recombinant yosW protein?

Recombinant yosW protein can be successfully produced using several expression systems with varying advantages depending on research requirements:

  • E. coli expression system: This represents the most accessible approach with rapid growth rates and high protein yields. For optimal expression, codon optimization for E. coli may be necessary since B. subtilis has a different codon usage bias .

  • Yeast expression system: Appropriate when post-translational modifications are required, as yeast provides a eukaryotic cellular environment while maintaining relatively simple culturing requirements .

  • Baculovirus/insect cell system: Offers superior folding environments for complex membrane proteins, potentially improving functional yield despite increased technical complexity .

  • Mammalian cell expression: Provides the most sophisticated post-translational modification machinery, recommended when studying protein-protein interactions that may require specific mammalian-like modifications .

  • Cell-free expression system: Enables rapid protein production and is particularly useful for potentially toxic membrane proteins like yosW that might interfere with host cell viability .

For all expression systems, achieving ≥85% purity as determined by SDS-PAGE appears consistently attainable according to available data . Selection should be based on the specific research requirements, including necessary post-translational modifications, functional activity preservation, and technical resources available.

What purification strategies work best for recombinant yosW membrane protein?

Purification of yosW, being a membrane protein, requires specialized techniques to maintain protein stability and functionality:

  • Detergent solubilization: Begin with membrane fraction isolation followed by solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin to extract the protein while preserving its native conformation.

  • Affinity chromatography: Utilizing a recombinant tag (His-tag appears common for commercial preparations) allows for selective binding to affinity resins . This typically achieves 60-70% purity in a single step.

  • Size exclusion chromatography: Follow affinity purification with size exclusion to separate monomeric protein from aggregates and further improve purity to the reported ≥85% level .

  • Ion exchange chromatography: May serve as an additional step based on the predicted isoelectric point of yosW if higher purity is required.

  • Quality control: Confirmatory SDS-PAGE analysis should be performed to verify purity , while circular dichroism may evaluate proper folding of the membrane protein.

The specific detergent:protein ratio requires optimization for each preparation, as excess detergent can interfere with downstream applications while insufficient amounts lead to protein aggregation and precipitation.

How can researchers characterize the membrane topology and protein interactions of yosW?

Characterizing the membrane topology and protein interactions of an uncharacterized membrane protein like yosW requires a multi-technique approach:

  • Computational prediction: Begin with transmembrane domain prediction using algorithms such as TMHMM, SOSUI, or Phobius to generate initial topology models, which provide a theoretical framework to guide experimental approaches.

  • Cysteine scanning mutagenesis: Systematically substitute amino acids with cysteine residues throughout the protein sequence and assess accessibility to membrane-impermeable sulfhydryl reagents. This technique can experimentally map which regions are exposed to either side of the membrane.

  • Fluorescence resonance energy transfer (FRET): Apply FRET analysis to measure distances between strategic positions within yosW or between yosW and other proteins of interest. This technique can reveal both structural information and identify potential interaction partners.

  • Co-immunoprecipitation with crosslinking: For identifying protein interaction partners, chemical crosslinking followed by co-immunoprecipitation and mass spectrometry can capture even transient interactions. Given that prophage-derived proteins like yosW may interact with bacterial cytoskeletal elements (drawing a parallel to findings for YodL and MreB interactions), investigating potential interactions with proteins like MreB would be particularly valuable .

  • Bacterial two-hybrid system: Adapted for membrane protein screening, this approach can systematically identify protein-protein interactions involving yosW within the bacterial cell context.

These approaches should be applied in combination, as each method has inherent limitations, but together they can provide a comprehensive characterization of yosW's membrane topology and interaction network.

What functional assays can determine if yosW affects bacterial cell morphology like other prophage-derived proteins?

Based on findings that other B. subtilis proteins (such as YodL) can modify cell shape through interactions with bacterial cytoskeletal proteins , several methodological approaches are recommended to assess if yosW possesses similar functions:

  • Controlled expression system: Utilize an inducible expression system (such as xylose-inducible promoter similar to the one used for comK in B. subtilis studies) to modulate yosW expression levels . This allows for dose-dependent assessment of morphological effects.

  • Phase-contrast and fluorescence microscopy: Implement time-lapse microscopy to monitor morphological changes following yosW induction. Measurements should include:

    • Cell length and width ratios

    • Formation of bulges or bends

    • Septation abnormalities

    • Growth rate alterations

  • Fluorescent tagging of cytoskeletal proteins: Co-visualization of yosW with MreB, Mbl, and other cytoskeletal proteins using fluorescent protein fusions can reveal potential colocalization or disruption patterns .

  • Peptidoglycan synthesis assay: Since MreB-family proteins guide peptidoglycan synthesis, incorporate fluorescent D-amino acids (FDAA) to track nascent peptidoglycan insertion patterns in the presence and absence of yosW expression .

  • Suppressor mutation screening: If yosW expression causes morphological defects, select for suppressor mutations that restore normal morphology. Sequence analysis of these suppressors may identify specific interaction partners, similar to how MreB mutations were identified as suppressors of YodL toxicity .

  • Electron microscopy: Utilize scanning and transmission electron microscopy to detect ultrastructural changes in cell envelope architecture following yosW expression.

The comparative analysis between yosW and better-characterized proteins like YodL and YisK would be particularly valuable, as these proteins have established roles in modulating MreB and Mbl activities respectively .

How does high salinity affect the expression and function of yosW during B. subtilis evolution experiments?

Investigating the relationship between high salinity and yosW expression/function requires methodological approaches that integrate evolutionary contexts with molecular mechanisms:

  • Evolutionary adaptation experiment: Design long-term evolution experiments where B. subtilis is subjected to high salinity stress (0.8M NaCl) for approximately 70-80 generations, similar to protocols used in previous studies . Compare wild-type strains with yosW deletion mutants to determine if this gene contributes to high-salt adaptation.

  • Transcriptomic analysis: Implement RNA-sequencing at multiple time points during salt adaptation to:

    • Track changes in yosW expression levels

    • Identify co-regulated genes that might function in the same pathway

    • Compare expression patterns in evolved versus ancestral populations

  • Comparative genomics: After evolution under high salinity, sequence the genomes of adapted populations to identify mutations. Special attention should be paid to:

    • Mutations in yosW itself

    • Mutations in genes encoding interacting partners

    • Changes in prophage regions generally

  • Competition assays: Conduct direct competition between yosW-expressing and yosW-deficient strains under high salinity conditions, following protocols similar to those described in evolutionary studies of B. subtilis .

  • Membrane integrity assessment: Since high salinity affects membrane properties, measure membrane fluidity and integrity in the presence and absence of yosW expression using fluorescent dyes and spectroscopic techniques.

This comprehensive approach can determine whether yosW contributes to adaptation to high salinity environments, which would provide insight into both the function of this uncharacterized protein and the evolutionary significance of prophage-derived genes in bacterial stress responses.

What controls are essential when studying an uncharacterized protein like yosW?

When designing experiments to study yosW, several critical controls must be incorporated to ensure result validity and interpretation:

  • Expression vector controls:

    • Empty vector control: Cells containing the expression vector without the yosW gene insert to account for vector-induced effects

    • Known protein control: Expression of a well-characterized membrane protein using the same vector and conditions to validate system functionality

  • Cellular localization controls:

    • Cytoplasmic marker protein (e.g., GFP)

    • Known membrane protein marker (e.g., MreB-fluorescent fusion) for colocalization studies

    • Periplasmic marker to distinguish membrane integration from peripheral association

  • Mutant controls for functional studies:

    • Point mutations in predicted functional domains

    • Truncation mutants lacking specific domains

    • Chimeric proteins where domains are swapped with related proteins

  • Physiological and stress condition controls:

    • Varying salt concentrations beyond the standard 0.8M NaCl to establish dose-dependency

    • Alternative stress conditions (pH, temperature) to determine specificity of any observed phenotypes

    • Growth phase monitoring to distinguish growth-phase dependent effects from protein-specific effects

  • Genetic background controls:

    • Wild-type B. subtilis strain

    • Strains with deletions in prophage regions excluding yosW

    • Strains with deletions in cytoskeletal genes if morphological effects are observed

These controls enable researchers to distinguish specific effects of yosW from experimental artifacts and to place any observed phenotypes in the proper cellular and physiological context.

How should contradictory data about yosW function be approached and resolved?

When faced with contradictory results regarding yosW function, a systematic approach to contradiction resolution includes:

  • Experimental condition reconciliation:

    • Create a detailed comparison table of all experimental conditions across contradictory studies, including strain backgrounds, media composition, and growth conditions

    • Systematically test each variable to identify condition-dependent effects

    • Determine if contradictions arise from differences in protein expression levels or experimental timescales

  • Methodological cross-validation:

    • Apply orthogonal techniques to verify the same hypothesis

    • If protein-protein interactions show contradictory results between yeast two-hybrid and co-immunoprecipitation studies, for instance, implement a third method such as FRET or SPR

    • Collaborate with laboratories reporting contradictory results to perform side-by-side experiments

  • Genetic suppressor analysis:

    • For functional contradictions, perform genetic suppressor screens as described for YodL/MreB interactions

    • Map suppressor mutations to identify pathways that may explain seemingly contradictory phenotypes

    • Consider that contradictions may reflect multiple, context-dependent functions of yosW

  • Protein structural heterogeneity assessment:

    • Characterize protein preparations using analytical techniques (SEC-MALS, CD spectroscopy)

    • Determine if contradictions arise from differences in protein conformational states

    • Verify protein integrity across different preparations

  • Creation of a contradiction resolution framework:

    • Develop testable hypotheses that could explain all observations

    • Design critical experiments specifically aimed at distinguishing between competing models

    • Consider the possibility that yosW may exhibit pleiotropy with distinct functions in different contexts

This systematic approach treats contradictions as valuable data points that may reveal important insights about context-dependent protein functions rather than as experimental failures.

What bioinformatic approaches are most effective for predicting yosW function?

A comprehensive bioinformatic strategy for predicting yosW function should integrate:

  • Sequence-based analysis:

    • Profile hidden Markov models to detect remote homologs beyond basic BLAST results

    • Conservation pattern analysis across Bacillus species and other bacteria containing SPBc2-like prophages

    • Identification of conserved domains and motifs, particularly those shared with other prophage-derived membrane proteins

  • Structural prediction and analysis:

    • AlphaFold2 or RoseTTAFold prediction of three-dimensional structure

    • Comparison with structural databases to identify proteins with similar folds despite low sequence similarity

    • Molecular dynamics simulations of membrane integration and potential conformational changes

  • Genomic context analysis:

    • Examination of neighboring genes within the prophage region

    • Detection of shared transcriptional regulation patterns through promoter analysis

    • Synteny analysis across multiple Bacillus strains to identify consistently co-occurring genes

  • Integration with experimental data:

    • Incorporation of transcriptomic data showing co-expression patterns

    • Analysis of protein-protein interaction networks from high-throughput studies

    • Correlation with phenotypic data from mutant libraries

  • Comparative analysis with characterized prophage proteins:

    • Functional comparison with YodL and YisK, which have established roles in modulating cytoskeletal proteins

    • Evaluation of potential shared mechanisms with other phage-derived membrane proteins

This integrated approach leverages multiple computational techniques to generate testable hypotheses about yosW function that can guide subsequent experimental validation.

How can researchers distinguish between direct and indirect effects of yosW on bacterial physiology?

Distinguishing direct from indirect effects of yosW requires methodological approaches that establish causality and mechanistic connections:

  • Temporal resolution studies:

    • Implement time-course experiments with fine temporal resolution following yosW induction

    • Utilize rapid induction systems with real-time monitoring of cellular responses

    • Apply statistical time-series analysis to determine the sequence of events following yosW expression

  • Dose-dependent response analysis:

    • Establish dose-response relationships using titratable expression systems

    • Determine thresholds for different phenotypes, as direct effects typically manifest at lower expression levels

    • Compare dose-dependency curves across multiple readouts to identify primary versus secondary effects

  • Genetic interaction mapping:

    • Perform synthetic genetic array analysis with yosW in various genetic backgrounds

    • Identify suppressors and enhancers of yosW-associated phenotypes

    • Construct genetic interaction networks to place yosW in cellular pathways

  • In vitro reconstitution:

    • Purify yosW and potential interaction partners for in vitro assays

    • Reconstitute minimal systems to test direct biochemical activities

    • Compare in vitro and in vivo effects to distinguish inherent activities from cellular context-dependent phenomena

  • Domain-specific mutational analysis:

    • Create a panel of point mutations affecting specific domains or features of yosW

    • Determine which mutations affect which phenotypes to create a domain-function map

    • Identify separation-of-function mutations that disrupt some activities while preserving others

This systematic approach can disentangle the complex phenotypic consequences of expressing an uncharacterized membrane protein like yosW, establishing which effects are directly caused by the protein versus those arising from downstream cellular responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.