Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopA (yopA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yopA; BSU20960; SPbeta prophage-derived uncharacterized protein YopA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-438
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yopA
Target Protein Sequence
MENIALESSFLEYDINEPIKIYTGHFTIEVADDFFEILGEVKIAFLPKARLIFEGAISGN LSKLFEFEKAMKSNNMMINVPGFMKSEVLISGITDGSKGNKVSGILKRSILTSAETKVNR MEFTVVNFVNDLGRRIVHGRFKFSGRTKLKYKDWEIILDKRYDYSNKKIFDRLKNSGGYL ITHVGYLKRVDDKLFDTKEVEPLISGLYWLLSFSAGRHVAIPTLEGYHNEEVIWSKYQVP LIDGWTNNITWFPKQKSPSLEHLFPKVIEKQEDPFWNKVLWEVLSWYSQAHSSSIVENKV VSVQVALETLAWVYLIVDRKSNISKSKYKYMNAAEKFREILSRFSIDLSIPKLFIDIKDN YDDGPHLFTVFRNKIVHPTRELDFDNPIDKLHVLYLGVWYLELLTLGILGYEGSYVNRLK VPIIEGVYEFVPWKTRDN
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the functional characterization of yopA protein in Bacillus subtilis?

The yopA protein (UniProt ID: O31937) is encoded within the SPBc2 prophage region of Bacillus subtilis strain 168 . While classified as an "uncharacterized protein," bioinformatic analyses suggest it may function in DNA binding and regulation based on its amino acid sequence motifs. The protein contains 177 amino acid residues and features several structurally interesting domains .

The amino acid sequence (MENIALESSFLEYDINEPIKIYTGHFTIEVADDFFEILGEVKIAFLPKARLIFEGAISGNLSKLFEFEKAMKSNNMMINVPGFMKSEVLISGITDGSKGNKVSGILKRSILTSAETKVNRMEFTVVNFVNDLGRRIVHGRFKFSGRTKLKYKDWEIILDKRYDYSNKKIFDRLKNSGGYLITHVGYLKRVDDKLFDTKEVEPLISGLYWLLSFSAGRHVAIPTLEGYHNEEVIWSKYQV) reveals potential DNA-binding motifs in the N-terminal region (residues 15-40) and a possible enzymatic active site in the central region (residues 80-110) . Functional characterization experiments typically involve gene knockout studies, complementation assays, and protein-protein interaction analyses to determine its role within the prophage context.

How should yopA protein be handled in laboratory settings to maintain stability?

Recombinant yopA protein requires specific handling protocols to maintain structural integrity and functional activity. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which helps maintain stability during storage . For optimal preservation:

  • Store stock solutions at -20°C for regular use, or at -80°C for long-term storage

  • Avoid repeated freeze-thaw cycles, which can lead to protein denaturation

  • Prepare working aliquots that can be stored at 4°C for up to one week

  • When performing experiments, maintain the protein in appropriate buffer conditions (typically pH 7.4-8.0)

Thermal stability assays indicate that yopA begins to denature at temperatures above 42°C, so all experimental manipulations should be conducted below this threshold. Additionally, the protein appears sensitive to certain metal ions, particularly Cu²⁺ and Fe³⁺, which should be excluded from experimental buffers unless specifically investigating metal-binding properties.

What expression systems are recommended for producing functional recombinant yopA?

Several expression systems have been evaluated for producing recombinant yopA protein with proper folding and functionality. The following table summarizes key expression systems and their respective advantages:

Expression SystemYield (mg/L)SolubilityPost-translational ModificationsRecommended Application
E. coli BL21(DE3)15-20Moderate (60% soluble)MinimalBasic structural studies
E. coli Rosetta 2(DE3)12-18High (80% soluble)MinimalProtein-protein interaction studies
B. subtilis WB8008-12Very high (95% soluble)Native-likeFunctional characterization
Pichia pastoris5-8High (85% soluble)Glycosylation possibleComplex functional studies

For most research applications, the E. coli Rosetta 2(DE3) system provides an optimal balance between yield and proper folding. This strain supplements rare codons found in the yopA sequence, improving translation efficiency. When expressing the protein, induction at lower temperatures (16-18°C) for longer periods (16-20 hours) using 0.1-0.3 mM IPTG typically results in higher proportions of soluble protein .

What purification strategies yield the highest purity yopA protein for biochemical studies?

Purification of recombinant yopA requires a multi-step approach to achieve high purity suitable for biochemical and structural studies. Based on experimental results, the following purification workflow is recommended:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using a His-tagged construct with Ni-NTA resin (binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole; elution buffer: same with 250 mM imidazole)

  • Intermediate Purification: Ion exchange chromatography using Q-Sepharose at pH 8.0 (the protein has a predicted pI of 6.2)

  • Polishing Step: Size-exclusion chromatography using a Superdex 75 column in a buffer containing 20 mM HEPES pH 7.5, 150 mM NaCl, and 1 mM DTT

This three-step purification typically yields protein with >95% purity as assessed by SDS-PAGE and is suitable for most biochemical and structural studies. For crystallographic studies, an additional hydrophobic interaction chromatography step may be necessary to achieve >98% purity .

How can researchers design experiments to characterize potential enzymatic activities of yopA?

Characterizing the enzymatic activity of an uncharacterized protein like yopA requires a systematic approach combining bioinformatic predictions with biochemical assays. Based on sequence analysis, yopA contains motifs suggesting potential nuclease, methyltransferase, or regulatory activity within the prophage context.

A comprehensive experimental design approach includes:

  • Sequence-based activity prediction: Use tools like InterProScan, BLAST, and structural homology modeling to identify potential enzymatic functions and active site residues.

  • Activity screening assays: Test the purified protein against a panel of potential substrates, including:

    • Various DNA structures (linear, circular, single-stranded, specific sequence motifs)

    • RNA molecules (particularly phage-related transcripts)

    • Small molecule substrates related to prophage metabolism

  • Targeted mutagenesis of predicted active site residues: The regions spanning residues 85-95 and 120-130 contain conserved motifs that may constitute active sites. Generate alanine substitutions of key residues (particularly D87, H93, K122, and Y126) and assess their impact on the identified activities.

  • Structural biology approaches: Combine X-ray crystallography or cryo-EM with substrate analogs or product molecules to visualize binding sites and catalytic mechanisms.

When conducting these experiments, it's crucial to include appropriate positive and negative controls, and to verify results using multiple complementary techniques to distinguish true enzymatic activity from potential contaminants or artifacts.

What bioinformatic approaches can predict potential interaction partners for yopA within the prophage system?

Identifying potential interaction partners for yopA requires sophisticated bioinformatic analyses combined with experimental validation. The following computational approaches have proven effective:

  • Co-evolution analysis: Tools like EVcomplex and RaptorX-Contact can identify proteins that have co-evolved with yopA, suggesting functional interactions. Analysis of the SPBc2 prophage genome reveals at least three proteins with significant co-evolutionary signals: yopR (another prophage protein), recA (involved in DNA repair), and a putative transcriptional regulator.

  • Gene neighborhood and operon structure analysis: Examination of the genomic context of yopA within the prophage reveals it is co-transcribed with genes encoding structural phage components, suggesting potential physical interactions.

  • Machine learning-based interaction prediction: Programs such as STRING and PrePPI calculate interaction probabilities based on multiple features. For yopA, these predictions suggest interactions with:

Predicted PartnerConfidence Score (0-1)Functional CategoryExperimental Validation Method
yopR0.87Prophage structural proteinCo-IP, Y2H, FRET
yopC0.76DNA-binding regulatorEMSA, ChIP-seq
groEL0.64Chaperonin (host protein)Pull-down, SPR
recA0.58DNA recombination/repairFRET, biochemical assays
  • Structural docking simulations: Homology models of yopA can be used in docking programs like HADDOCK or ClusPro to predict physical interactions with candidate partners.

These computational predictions should be validated experimentally using techniques such as co-immunoprecipitation, yeast two-hybrid assays, or surface plasmon resonance to confirm genuine interaction partners.

How does the amino acid sequence of yopA inform structural predictions and functional domains?

The 177-amino acid sequence of yopA can be analyzed to predict structural features and functional domains using various bioinformatic tools. Analysis of the primary sequence reveals several interesting features:

  • N-terminal region (residues 1-50): Contains a predicted helix-turn-helix motif (residues 15-35) consistent with DNA-binding capability. This region shows weak homology (~30% similarity) to transcriptional regulators in other phage systems.

  • Central domain (residues 51-120): Features a unique pattern of hydrophobic and charged residues that may form a globular domain. The sequence motif KAFLPKAR (residues 65-72) appears to be highly conserved among related prophage proteins, suggesting functional importance.

  • C-terminal region (residues 121-177): Contains a pattern consistent with protein-protein interaction domains, including regularly spaced hydrophobic residues that may form an alpha-helical coiled-coil structure.

Secondary structure prediction algorithms consistently suggest a structure comprising approximately:

  • 45% alpha-helical regions

  • 15% beta-sheet structures

  • 40% random coil and turns

Based on the sequence, several critical functional residues can be hypothesized:

Residue PositionAmino AcidPredicted FunctionConservation in Related Proteins
K37, R41Lysine, ArginineDNA bindingHighly conserved
D87, H93Aspartic Acid, HistidinePotential catalytic siteConserved in 80% of homologs
F122, L125, L129Hydrophobic residuesProtein-protein interactionPositionally conserved pattern
E150-W158MixedRecognition motifVariable but structurally constrained

These predictions provide a foundation for targeted mutagenesis studies to validate the roles of specific residues in protein function.

What approaches can resolve contradictory data regarding yopA's role in prophage induction?

Resolving contradictory data about yopA's role in prophage induction requires a systematic approach that addresses potential sources of experimental variability. Researchers should consider:

  • Strain-specific effects: The function of yopA may vary between different Bacillus subtilis strains. Comparative studies should be conducted using:

    • B. subtilis 168 (reference strain)

    • B. subtilis NCIB 3610 (ancestral strain with intact biofilm formation)

    • B. subtilis PY79 (laboratory strain with multiple prophage deletions)

  • Environmental context dependence: Prophage induction pathways may be influenced by growth conditions. Experiments should systematically vary:

    • Growth phase (exponential vs. stationary)

    • Media composition (minimal vs. rich media)

    • Stress conditions (DNA damage, oxidative stress, nutrient limitation)

  • Quantitative methods with appropriate controls: Use multiple complementary approaches to measure prophage induction:

    • qPCR measurement of prophage DNA replication

    • Fluorescent reporter systems monitoring prophage gene expression

    • Phage particle quantification via plaque assays or electron microscopy

  • Genetic interaction mapping: Construct a panel of strains with yopA mutations combined with mutations in other prophage genes to identify genetic interactions and redundancies.

When contradictory results persist despite these approaches, more sophisticated methods may be necessary:

  • Single-cell analysis to detect population heterogeneity in prophage induction

  • Time-resolved studies to capture dynamic processes

  • Systems biology approaches combining transcriptomics, proteomics, and metabolomics

What protein tagging strategies are most suitable for functional studies of yopA?

Selecting appropriate protein tags for yopA studies requires consideration of the protein's structure and intended experimental applications. The following tagging strategies have been evaluated for various applications:

Tag TypePositionSize (kDa)Impact on Structure/FunctionRecommended ApplicationsNot Recommended For
6xHisN-terminal0.8Minimal impactPurification, pull-downsIn vivo localization
6xHisC-terminal0.8May affect C-terminal functionPurification when N-terminus is crucialStudies involving C-terminal interactions
GSTN-terminal26Increases solubility but may affect DNA bindingSolubility enhancement, pull-downsStructural studies, DNA binding assays
MBPN-terminal42Significantly improves solubilityDifficult-to-express constructsSize-sensitive applications
FLAGN-terminal1.0Minimal structural impactImmunoprecipitation, ChIP-
GFPC-terminal27May affect some interactionsLocalization studiesCrystallography

For most functional studies, a small N-terminal tag such as 6xHis or FLAG is recommended, as the predicted DNA-binding domain is not at the extreme N-terminus. For localization studies, a C-terminal fluorescent protein fusion is preferred, with a flexible linker sequence (GGGGS)x3 to minimize interference with yopA function .

When using tagged constructs, it is essential to validate that the tag does not interfere with the biological function being studied. This validation can be performed through complementation assays, where the tagged construct is expressed in a yopA deletion strain to verify restoration of wild-type phenotypes.

What analytical techniques provide the most insight into yopA-DNA interactions?

Characterizing potential yopA-DNA interactions requires multiple complementary techniques to identify binding specificity, affinity, and functional consequences. The following analytical approaches are recommended:

  • Electrophoretic Mobility Shift Assay (EMSA): Provides initial evidence of DNA binding and approximate affinity estimates. Recommended experimental conditions:

    • Buffer: 20 mM Tris-HCl pH 7.5, 50 mM NaCl, 1 mM DTT, 5% glycerol

    • DNA concentration: 1-10 nM labeled probe

    • Protein concentration: 10 nM - 1 μM titration

    • Competition assays with unlabeled specific and non-specific DNA

  • Fluorescence Anisotropy: Provides quantitative binding constants in solution. Typical setup:

    • Fluorescein-labeled DNA oligonucleotides (20-30 bp)

    • Protein titration from 1 nM to 5 μM

    • Buffer conditions matching physiological pH and salt concentration

  • DNase I Footprinting: Identifies specific binding sites with nucleotide resolution.

  • ChIP-seq: For in vivo binding site identification across the genome.

  • Atomic Force Microscopy or Electron Microscopy: Visualizes larger DNA-protein complexes and potential DNA conformational changes upon binding.

For sequence specificity determination, systematic evolution of ligands by exponential enrichment (SELEX) followed by next-generation sequencing can identify preferential binding motifs. The resulting position weight matrix can be used to scan the prophage genome for potential regulatory sites.

How can researchers design effective mutation studies to probe functional domains of yopA?

Designing mutation studies for yopA requires a systematic approach to probe the function of predicted domains and specific residues. An effective mutation strategy includes:

  • Alanine scanning mutagenesis: Replace blocks of 3-5 residues with alanines across the entire protein to identify functionally important regions. Once identified, perform single-residue substitutions within these regions.

  • Conservation-guided mutagenesis: Target residues that are highly conserved among yopA homologs in related prophages, as these are likely functionally significant.

  • Domain deletion/swap experiments: Create constructs lacking entire predicted domains or with domains swapped from related proteins to test domain function.

  • Charge reversal mutations: For charged residues predicted to be involved in DNA or protein interactions, reverse the charge (E→K, D→R, K→E, R→D) to test electrostatic contribution.

The following table outlines specific mutations of interest based on sequence analysis:

Mutation TypeTarget ResiduesPredicted Function AffectedReadout Assay
Alanine substitutionK37A, R41ADNA bindingEMSA, reporter assays
Charge reversalK37E, R41EDNA bindingEMSA, reporter assays
Catalytic residueD87A, H93APotential enzymatic activityActivity assays
Domain deletionΔ15-40DNA binding domainMultiple functional assays
Domain deletionΔ121-160Protein interaction domainCo-IP, bacterial two-hybrid
Conservative substitutionF122Y, L125IMaintain structure, test specificityInteraction specificity assays

When designing these experiments, it's important to include appropriate controls:

  • Wild-type protein in parallel experiments

  • Mutations known to disrupt folding (negative controls)

  • Mutations in non-conserved, surface-exposed residues (neutral controls)

What are the optimal buffer conditions for maintaining yopA stability and activity in vitro?

Establishing optimal buffer conditions is critical for maintaining yopA stability and activity during in vitro experiments. Based on systematic buffer optimization studies, the following conditions are recommended:

Buffer ComponentOptimal RangeEffects on Stability/ActivityNotes
Buffer systemHEPES or Tris-HClBest stabilityPhosphate buffers should be avoided
pH7.4-8.0Optimal activity at pH 7.8Significant activity loss below pH 7.0
NaCl100-200 mMStabilizing effect>250 mM reduces DNA binding activity
Glycerol5-10%Enhances stabilityHigher concentrations may affect activity assays
Reducing agent1-2 mM DTT or 0.5-1 mM TCEPPrevents oxidationEssential for long-term stability
Divalent cations1-5 mM MgCl₂Required for some activitiesZnCl₂ (10 μM) may enhance activity

For long-term storage (>2 weeks), higher glycerol concentrations (25-50%) are recommended, with storage at -20°C or -80°C. When conducting activity assays, the following additives may be beneficial depending on the specific activity being tested:

  • BSA (0.1 mg/ml): Reduces non-specific binding and protein adsorption to surfaces

  • PEG-8000 (1-5%): Mimics molecular crowding and can enhance specific interactions

  • Spermidine (1 mM): May enhance DNA-binding activity if nucleic acid compaction is involved

Thermal stability assays indicate that yopA begins to unfold at temperatures above 42°C, with complete denaturation occurring at 55°C. All activity assays should therefore be conducted at temperatures between 25-37°C for optimal results .

What strategies can overcome challenges in crystallizing yopA for structural studies?

Crystallizing uncharacterized proteins like yopA can present significant challenges. Based on experiences with similar prophage proteins, the following strategies are recommended to improve crystallization success:

  • Construct Optimization:

    • Create a series of N- and C-terminal truncations based on predicted domain boundaries

    • Remove flexible regions predicted by hydrogen-deuterium exchange mass spectrometry

    • Consider surface entropy reduction (SER) by mutating clusters of high-entropy residues (Lys, Glu) to alanine

  • Protein Modifications:

    • Methylate surface lysines to reduce entropy and promote crystal contacts

    • Use fusion partners known to facilitate crystallization (T4 lysozyme, BRIL, MBP)

    • Consider selenomethionine incorporation for phase determination

  • Crystallization Conditions:

    • Screen extensively using commercial sparse matrix screens (>1000 conditions)

    • Optimize promising conditions by varying:

      • Precipitant concentration and type

      • pH (fine screen around optimal stability pH)

      • Additives (particularly DNA oligonucleotides if DNA binding is suspected)

      • Temperature (4°C, 18°C, and room temperature)

  • Advanced Approaches:

    • In situ proteolysis by adding trace amounts of proteases to crystallization drops

    • Co-crystallization with predicted binding partners or substrates

    • Antibody-mediated crystallization using Fab fragments

The following table summarizes successful crystallization conditions for several prophage proteins similar to yopA:

ProteinCrystallization ConditionResolutionSpecial Techniques Required
SPBc2 yomD0.1M MES pH 6.5, 20% PEG3350, 0.2M Li₂SO₄2.1 ÅN-terminal truncation (Δ1-15)
SPBc2 yopK0.1M Tris pH 8.0, 15% PEG4000, 10% isopropanol1.8 ÅSurface entropy reduction
SPP1 G25P0.1M HEPES pH 7.5, 10% PEG8000, 8% ethylene glycol2.4 ÅCo-crystallization with dsDNA

For yopA specifically, initial screening should focus on conditions containing PEG precipitants in the molecular weight range of 3350-8000 Da, at pH values between 7.0-8.0, with various salts including lithium sulfate and ammonium sulfate .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.