Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopH (yopH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yopH; BSU20890; SPbeta prophage-derived uncharacterized protein YopH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yopH
Target Protein Sequence
MSDQNEKSPSWVGDIIKLSPKYLLGLAVFSGIGLWLGNVGLGKTLGIKDAINSYKLYLGL VFLASTSFILSHFIWWISLGIKNKIDQKYSYKLQKERLRNLNRREKQILSPYIFDDVRSV ELSITDGTAQELEHLKIIYRSSNISNRGSYFAYNIQPWARGYLTKNKHLLHESIDHIL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis SPBc2 prophage and its uncharacterized proteins?

Bacillus subtilis contains several prophage elements in its genome, including SPBc2, which contains various uncharacterized proteins such as YopI, YosC, and YopH. These proteins are viral in origin but have become integrated into the bacterial genome through horizontal gene transfer events. SPBc2 prophage-derived proteins typically have unknown functions but may play roles in bacterial physiology, sporulation, or defense mechanisms.

The SPBc2 prophage-derived proteins are named with the prefix "yo-" followed by a letter designation. For example, YopI (177 amino acids) has been identified as a prophage-derived uncharacterized protein with a specific amino acid sequence that includes transmembrane domains . Similar prophage-derived proteins like YosC have also been documented in strain 168 of Bacillus subtilis .

What expression systems are suitable for recombinant prophage-derived proteins?

The expression of recombinant prophage-derived proteins can be accomplished using several systems, with B. subtilis itself serving as an excellent expression host. Research indicates that B. subtilis can efficiently express recombinant proteins using appropriate vectors and induction systems.

The pHT43 vector system has been successfully used for recombinant protein expression in B. subtilis. This system utilizes IPTG induction at a final concentration of 1 mmol/L to trigger protein expression. The process typically involves:

  • Constructing a recombinant plasmid with the target gene

  • Transforming the plasmid into B. subtilis using electrotransformation (typical conditions: 2000 V, 5 ms, 200 Ω, 25 μF)

  • Inducing expression with IPTG when cultures reach OD600 of approximately 0.8

  • Incubating at 37°C with shaking at 220 rpm for 4-6 hours

  • Harvesting the protein through ultrasonic fragmentation or other extraction methods

How can researchers verify successful cloning and expression?

Verification of successful cloning and expression involves several key methodologies:

For cloning verification:

  • PCR verification using plasmid-specific primers

  • Restriction enzyme digestion to confirm insert size

  • DNA sequencing to verify the correct sequence

For expression verification:

  • SDS-PAGE to confirm protein size

  • Western blot analysis using specific antibodies

  • Mass spectrometry to confirm protein identity

Research examples demonstrate that verification can be performed by digesting recombinant plasmids with restriction enzymes like BamHI and SmaI, followed by gel electrophoresis to confirm the presence of both vector and insert bands of expected sizes. For instance, in one study, researchers observed a vector band of 8057 bp and a target fragment band of 723 bp after double digestion, confirming successful recombination .

What are the common storage conditions for recombinant prophage-derived proteins?

Recombinant prophage-derived proteins require specific storage conditions to maintain stability and activity:

Storage ConditionPurposeRecommendation
Short-term storageMaintaining activity for immediate use4°C for up to one week
Medium-term storagePreserving protein for weeks to months-20°C in appropriate buffer
Long-term storageMaintaining stability for extended periods-80°C in buffer with 50% glycerol
Buffer compositionProtein stabilizationTris-based buffer with 50% glycerol, optimized for the specific protein

Repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of activity. Working aliquots should be prepared and stored at 4°C for up to one week .

What experimental approaches can identify the function of uncharacterized prophage proteins?

Determining the function of uncharacterized prophage proteins requires a multi-faceted approach:

  • Bioinformatic analysis:

    • Sequence homology searches against known protein databases

    • Structural prediction using tools like AlphaFold or Rosetta

    • Domain identification to predict potential functions

    • Phylogenetic analysis to trace evolutionary relationships

  • Gene knockout studies:

    • Creating deletion mutants to observe phenotypic changes

    • Complementation studies to confirm gene function

    • Comparative analysis with wild-type strains

  • Protein interaction studies:

    • Pull-down assays to identify binding partners

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

Research has demonstrated that studying the phenotypes of deletion mutants can reveal functional roles of uncharacterized proteins. For example, studies of B. subtilis mutants have categorized genes into different phenotypic categories based on sporulation efficiency, including those that produce high levels of visible and heat-resistant spores (Category I), those with defects in heat-resistant spore formation (Category II), and others with distinct phenotypic characteristics (Categories III and IV) .

How should researchers approach contradictory data when studying uncharacterized proteins?

When faced with contradictory data during the study of uncharacterized proteins, researchers should follow a systematic approach:

  • Data verification:

    • Re-examine original data for potential errors or anomalies

    • Identify any outliers that may be skewing results

    • Compare findings with existing literature on similar proteins

  • Experimental design review:

    • Evaluate initial assumptions and research design

    • Assess potential confounding variables

    • Consider alternative hypotheses that might explain the contradictions

  • Methodology refinement:

    • Modify data collection processes if necessary

    • Implement additional controls

    • Refine variables to increase precision

  • Alternative explanations:

    • Consider if the protein might have multiple functions

    • Evaluate if environmental conditions affect protein behavior

    • Assess if post-translational modifications play a role

Research indicates that approaching contradictory data with an open mind can lead to new discoveries. It's crucial to thoroughly examine findings, identify discrepancies, and use comparative analysis with existing literature to gain insights into the complexities of the data .

What techniques are most effective for structural characterization of prophage-derived proteins?

Structural characterization of prophage-derived proteins can be achieved through various complementary techniques:

For virus-like particles (VLPs) formed by some prophage-derived proteins, transmission electron microscopy (TEM) has proven effective in visualizing their structure. For instance, the Cap protein of PCV2d expressed in B. subtilis was observed to form VLPs under TEM, providing crucial structural information about the recombinant protein .

How can evolutionary analysis inform functional predictions for uncharacterized prophage proteins?

Evolutionary analysis provides valuable insights into potential functions of uncharacterized prophage proteins:

  • Phylostratigraphy approaches:

    • Assigning proteins to specific phylostrata (PS) based on their evolutionary emergence

    • Identifying connections between evolutionarily related proteins

    • Using phylogenetic patterns to predict potential functions

  • Conservation analysis:

    • Examining conservation patterns across bacterial species

    • Identifying conserved domains that may indicate function

    • Analyzing selection pressure on specific regions

  • Co-evolution studies:

    • Identifying proteins that co-evolve with the uncharacterized protein

    • Inferring functional relationships based on evolutionary trajectories

    • Predicting interaction networks

Research has shown that prophage-derived genes appearing in specific phylostrata (PS) often share functional characteristics. For example, in B. subtilis, sporulation genes that originated in PS2 and PS8-10 have been identified as critical for the sporulation process. This evolutionary pattern has guided researchers to identify previously uncharacterized genes that might be involved in sporulation .

What immunological applications exist for recombinant prophage-derived proteins?

Recombinant prophage-derived proteins can have various immunological applications:

  • Vaccine development:

    • Use as carrier proteins for antigenic epitopes

    • Development of virus-like particles (VLPs) as vaccine candidates

    • Oral vaccine delivery systems using B. subtilis as a vector

  • Diagnostic tools:

    • Development of ELISA kits for antibody detection

    • Production of recombinant antigens for serological testing

    • Generation of reference standards for immunoassays

  • Immunomodulatory studies:

    • Investigation of effects on innate and adaptive immunity

    • Evaluation of mucosal immune responses

    • Assessment of antibody production in response to protein exposure

Research has demonstrated that recombinant B. subtilis expressing proteins like PCV2d Cap can induce effective mucosal and humoral immunity when administered orally to mice. The recombinant bacteria can elevate levels of protein-specific IgG in serum and sIgA in intestinal fluid, suggesting potential applications in vaccine development .

What are the optimal conditions for expressing recombinant prophage proteins in B. subtilis?

Optimizing expression conditions for recombinant prophage proteins in B. subtilis involves several key parameters:

  • Vector selection:

    • pHT43 vector system with IPTG-inducible promoter

    • Vectors with signal peptides for secreted expression

    • Integration vectors for stable chromosome-based expression

  • Growth and induction conditions:

    • Culture medium: LB or modified media based on protein requirements

    • Growth temperature: typically 37°C for standard expression

    • Induction: IPTG at 1 mmol/L final concentration

    • Post-induction incubation: 4-6 hours at 37°C with 220 rpm shaking

  • Strain selection:

    • B. subtilis WB800 strain for reduced protease activity

    • Specialized strains based on protein characteristics

    • Consideration of codon optimization for the target protein

  • Protein extraction:

    • Ultrasonic fragmentation for intracellular proteins

    • Collection of culture supernatant for secreted proteins

    • Optimization of lysis buffers based on protein properties

Research has shown that successful transformation of recombinant plasmids into B. subtilis can be achieved using electroporation with specific parameters (2000 V, 5 ms, 200 Ω, 25 μF), followed by selection on appropriate antibiotic-containing media .

How can researchers effectively purify and characterize recombinant prophage proteins?

Purification and characterization of recombinant prophage proteins require specialized techniques:

Purification strategies:

  • Affinity chromatography using appropriate tags (His-tag, GST, etc.)

  • Ion exchange chromatography based on protein charge

  • Size exclusion chromatography for final polishing

  • Concentration methods optimized for protein stability

Characterization methods:

  • SDS-PAGE for purity assessment and molecular weight determination

  • Western blotting for specific detection

  • Mass spectrometry for identity confirmation and modification analysis

  • Functional assays based on predicted protein activities

For example, concentrated supernatants of recombinant B. subtilis expressing PCV2d Cap protein were analyzed under transmission electron microscopy to confirm the formation of virus-like particles (VLPs), demonstrating the importance of appropriate characterization techniques for understanding protein function and structure .

What strategies can address poor expression of prophage-derived proteins?

Poor expression of prophage-derived proteins can be addressed through systematic troubleshooting:

ChallengePotential CausesSolutions
Low expression levelsPromoter inefficiencyTry alternative promoters or induction systems
Protein toxicityUse tightly regulated expression systems
Codon biasOptimize codons for B. subtilis expression
Protein degradationProtease activityUse protease-deficient strains (e.g., WB800)
Protein instabilityModify growth temperature or add stabilizing agents
Inclusion body formationProtein misfoldingLower induction temperature or reduce induction strength
High expression rateOptimize induction conditions and duration
Poor secretionSignal peptide issuesTest alternative signal peptides
Protein folding problemsCo-express chaperones or folding catalysts

Optimizing expression conditions through systematic testing of parameters such as induction time, concentration of inducer, temperature, and growth medium composition can significantly improve protein expression levels.

How can researchers validate hypotheses about protein function when facing contradictory data?

When facing contradictory data during functional studies of prophage-derived proteins, researchers should implement a validation framework:

  • Independent verification:

    • Repeat experiments using alternative methodologies

    • Collaborate with other laboratories for independent validation

    • Use complementary approaches to test the same hypothesis

  • Control expansions:

    • Implement additional positive and negative controls

    • Include isogenic mutants with known phenotypes

    • Use related proteins with known functions as benchmarks

  • Parameter modulation:

    • Test function under varying conditions (pH, temperature, etc.)

    • Evaluate concentration-dependent effects

    • Assess time-dependent changes in activity

  • Multi-omics integration:

    • Combine proteomic, transcriptomic, and metabolomic data

    • Correlate functional observations with global cellular changes

    • Use systems biology approaches to understand protein in context

Research indicates that approaching contradictory data with an open mind can lead to new discoveries. It's essential to thoroughly examine findings, identify discrepancies, and conduct comprehensive analysis to gain insights into complex biological systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.