Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopI (yopI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yopI; BSU20880; SPbeta prophage-derived uncharacterized protein YopI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yopI
Target Protein Sequence
MNNIGEIISNFEGIIGALLGVIVTLILTHILKHFGQIKFYIVDFEIYFKTDNDGWGTNVM PSKDEAKQIEIHSQIEIYNGAEIPKVLREIKFCFYKNTNLIVSVTPDDKATTEEFAEFGY YRDKLFNINLPSKQIIAINIIKFLNEKETKQVKKCNRVYLEAKDHNGKMYKVFLGEF
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structure and function of the YopI protein?

YopI (UniProt ID: O31929) is a 177-amino acid protein derived from the SPBc2 prophage in Bacillus subtilis . The full amino acid sequence is: MNNIGEIISNFEGIIGALLGVIVTLILTHILKHFGQIKFYIVDFEIYFKTDNDGWGTNVMPSKDEAKQIEIHSQIEIYNGAEIPKVLREIKFCFYKNTNLIVSVTPDDKATTEEFAEFGYYRDKLFNINLPSKQIIAINIIKFLNEKETKQVKKCNRVYLEAKDHNGKMYKVFLGEF . While YopI itself remains uncharacterized, structural studies of related prophage proteins like YopR suggest that proteins in this family may have DNA-binding capabilities with folds resembling recombinases . Based on pattern recognition and sequence analysis, YopI likely contains transmembrane domains as indicated by the hydrophobic regions in its sequence, potentially suggesting membrane association. Researchers should consider investigating potential roles in prophage regulation, similar to how YopR has been identified as crucial for maintenance of lysogeny in the SPβ prophage system .

What expression systems are suitable for recombinant YopI production?

E. coli expression systems have been successfully employed for the recombinant production of His-tagged YopI protein . When expressing YopI, researchers typically use an N-terminal His-tag to facilitate purification via affinity chromatography . The protein is commonly supplied as a lyophilized powder after purification to greater than 90% homogeneity as determined by SDS-PAGE . For storage stability, it's recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol as a stabilizing agent (with 50% being the default concentration) . To minimize protein degradation during experimental work, researchers should avoid repeated freeze-thaw cycles and can store working aliquots at 4°C for up to one week while keeping long-term stocks at -20°C or -80°C .

How does YopI relate to the SPβ prophage regulatory system?

While YopI's specific role remains uncharacterized, recent research on the SPβ prophage has identified an arbitrium system that regulates the prophage's replication stage and lysis-lysogeny decision . Studies on related proteins like YopR have demonstrated their crucial function in lysogeny maintenance, with YopR specifically shown to be a DNA-binding protein structurally similar to tyrosine recombinases . The SPβ c2 prophage, a heat-sensitive variant, has been valuable in studying these regulatory mechanisms, revealing that certain protein mutations (like YopR G136E) can create temperature-sensitive phenotypes that affect prophage stability . YopI may potentially participate in similar regulatory pathways, perhaps interacting with other prophage-encoded proteins like YopR or YosL, which has been identified as a novel component of the lysis-lysogeny management system . Understanding YopI within this context requires consideration of the complex interplay between multiple prophage components that collectively determine phage lifecycle decisions.

What DNA-binding properties might YopI possess and how can they be characterized?

Given the structural similarities between prophage proteins and the finding that YopR functions as a DNA-binding protein with a fold resembling tyrosine recombinases , researchers should investigate whether YopI exhibits similar DNA-binding properties. Electrophoretic mobility shift assays (EMSAs) would be an appropriate starting point to determine if YopI interacts with DNA and to characterize the binding specificity if present. Chromatin immunoprecipitation followed by sequencing (ChIP-seq) could identify genomic binding sites in vivo, potentially revealing regulatory targets within the Bacillus subtilis genome or the prophage sequence itself. X-ray crystallography or cryo-electron microscopy (cryo-EM) studies of YopI in complex with putative DNA targets would provide detailed structural insights into binding mechanisms and potential allosteric regulation. Researchers should also consider mutagenesis studies targeting predicted DNA-binding domains to establish structure-function relationships, similar to how the G136E mutation was identified as critical for YopR's temperature-sensitive properties .

How does YopI potentially interact with other prophage-encoded proteins in the regulation of lysogeny?

Prophage regulation typically involves complex protein-protein interaction networks, as evidenced by the identification of multiple regulatory components in the SPβ system, including YopR and YosL . To investigate YopI's potential role in this network, researchers should employ co-immunoprecipitation (co-IP) assays coupled with mass spectrometry to identify binding partners. Bacterial two-hybrid assays provide an alternative approach to screen for protein-protein interactions in vivo. Functional studies using gene knockout or knockdown techniques can reveal epistatic relationships between YopI and other prophage regulators. Advanced techniques such as proximity-dependent biotin identification (BioID) or APEX2-based proximity labeling could map the protein interaction landscape surrounding YopI within the cellular context. Comparing interaction profiles under conditions favoring lysogeny versus lytic growth would be particularly informative in understanding how these protein networks dynamically regulate prophage behavior in response to environmental cues.

What evolutionary relationships exist between YopI and related proteins in other prophage systems?

Comparative genomic analysis should be employed to identify YopI homologs across different Bacillus species and related bacterial prophages. Phylogenetic analysis can reveal evolutionary relationships and potential functional conservation or divergence. Researchers should examine synteny—the conservation of gene order—around the yopI locus across related prophages to identify potentially co-evolved functional units. Domain architecture analysis may reveal conserved motifs that suggest functional roles. Selection pressure analysis (dN/dS ratios) across homologs could indicate regions under purifying or diversifying selection, pointing to functionally critical domains. The identification of horizontal gene transfer events involving yopI would provide insights into the mobility and spread of this gene across bacterial populations. Structural comparisons with characterized proteins like YopR could reveal shared functional elements despite potential sequence divergence, as proteins can maintain structural and functional similarity even with limited sequence identity.

What techniques are available for genetic manipulation of YopI in Bacillus subtilis?

Several advanced methods exist for genetic manipulation of prophage genes like yopI in B. subtilis. One novel approach combines the use of blaI (encoding a repressor involved in Bacillus licheniformis BlaP β-lactamase regulation), an antibiotic resistance gene, and a B. subtilis strain that is conditionally auxotrophic for lysine . This integrative method allows researchers to create marker-free modifications of the B. subtilis chromosome, which is particularly valuable when studying prophage genes where marker presence might interfere with native regulation . The technique involves constructing a BlaI cassette containing the blaI and spectinomycin resistance genes flanked by short direct repeat DNA sequences, which facilitates subsequent cassette removal through single crossover events . Alternatively, researchers can employ the upp cassette method developed by Fabret et al., which uses uracylphosphoribosyl transferase as a counterselection marker in a B. subtilis strain deleted for the upp gene, conferring resistance to 5-fluorouracyl . These marker-free systems are especially valuable for studying prophage genes, as they allow multiple sequential modifications without permanently introducing selection markers that might influence strain physiology.

How can researchers study the structural characteristics of YopI protein?

To elucidate YopI's structure, researchers should consider a multi-technique approach. X-ray crystallography remains a gold standard, requiring purification of recombinant His-tagged YopI to near homogeneity (>90% purity) , followed by crystallization trials under varying conditions to identify optimal crystal-forming parameters. Nuclear magnetic resonance (NMR) spectroscopy provides an alternative approach that can reveal dynamic structural information, particularly valuable if YopI contains disordered regions. Cryo-electron microscopy (cryo-EM) has become increasingly powerful for protein structure determination, especially when coupled with focused ion beam milling (cryo-FIB-ET) as demonstrated in studies of B. subtilis cellular structures . Circular dichroism (CD) spectroscopy can provide initial insights into secondary structure content and thermal stability, which could be particularly informative if YopI exhibits temperature-dependent conformational changes similar to the temperature-sensitive behavior observed in YopR G136E . Hydrogen-deuterium exchange mass spectrometry (HDX-MS) would be valuable for mapping dynamic regions and potential ligand-binding sites, providing complementary information to static structural techniques.

What approaches can be used to identify YopI's role in prophage induction and lysogeny maintenance?

To determine YopI's potential role in prophage regulation, researchers should employ both genetic and biochemical approaches. Gene deletion or controlled expression studies can reveal phenotypic effects on prophage stability and induction rates. The heat-sensitive SPβ c2 mutant system provides an excellent model for studying temperature-dependent prophage induction, as demonstrated with YopR . Time-course transcriptomic analysis using RNA-seq during prophage induction would identify gene expression changes and regulatory networks associated with YopI. Chromatin immunoprecipitation followed by sequencing (ChIP-seq) could map YopI's potential DNA binding sites across the bacterial and prophage genomes. Co-immunoprecipitation coupled with mass spectrometry would identify protein interaction partners that might provide functional context. Single-cell microscopy techniques using fluorescently-tagged YopI could track its localization during different phases of the lysogenic and lytic cycles. Evolution experiments similar to those that identified YosL's role in the lysis-lysogeny management system could reveal genetic suppressors or enhancers of YopI function, providing additional insights into its regulatory network .

How can researchers investigate potential interactions between YopI and the bacterial cell membrane?

The amino acid sequence of YopI contains hydrophobic regions that suggest potential membrane association . To investigate this, researchers should employ both computational and experimental approaches. Computational predictions using tools like TMHMM, Phobius, or MEMSAT can identify putative transmembrane domains. Experimentally, membrane fractionation followed by Western blotting can determine YopI's subcellular localization. Fluorescence microscopy using GFP-tagged YopI would visualize its distribution in live cells. For more detailed structural analysis, cryo-electron tomography coupled with cryo-focused ion beam milling (cryo-FIB-ET) has proven effective for visualizing bacterial cellular structures at molecular resolution within their native state, as demonstrated in studies of B. subtilis sporulation . This technique could potentially capture YopI's interaction with membranes in situ. Biochemical approaches such as liposome binding assays and protease protection assays would provide complementary information about membrane topology. Identifying specific lipid binding preferences through lipid overlay assays or lipidomics analyses could reveal functional interactions with specific membrane components that might regulate YopI activity or localization.

How should researchers interpret structural and functional data for YopI in the context of prophage biology?

When analyzing structural and functional data for YopI, researchers should consider the broader context of prophage regulation exemplified by related proteins like YopR. YopR has been shown to be a DNA-binding protein with a fold resembling tyrosine recombinases, although it has lost its recombinase function . Any structural features identified in YopI should be interpreted in light of the regulatory networks governing prophage lifestyle decisions. Analysis of domain architecture should focus on identifying potential DNA-binding motifs, protein-protein interaction interfaces, or membrane-association domains suggested by YopI's amino acid sequence . Functional assays should examine YopI's potential role in lysogeny maintenance by comparing wild-type and mutant phenotypes under varying environmental conditions. Researchers should interpret temperature-dependent effects carefully, considering the precedent set by the temperature-sensitive YopR G136E mutation that impairs higher-order structure and DNA binding activity . When analyzing protein interaction data, prioritize interactions that connect YopI to known regulators like YopR or YosL, as these connections would place YopI within the established prophage regulatory framework.

What bioinformatic tools and databases are most useful for analyzing YopI and related prophage proteins?

Researchers studying YopI should utilize specialized bioinformatic resources tailored to prophage and bacterial protein analysis. The Bacillus Genetic Stock Center (BGSC) maintains strain collections and genetic information for B. subtilis and its prophages. Prophage databases like PHASTER and Prophage Hunter can identify related prophage regions across bacterial genomes. For structural predictions, AlphaFold and RoseTTAFold have revolutionized protein structure prediction and can generate high-confidence models even for proteins with limited homology to known structures. Domain prediction tools like InterPro, Pfam, and CDD should be used to identify conserved domains that might suggest function. Operon and regulatory network databases like DBTBS (Database of Transcriptional Regulation in Bacillus subtilis) provide context for gene regulation. Phylogenetic analysis tools including MEGA, PhyML, and MrBayes help reconstruct evolutionary relationships between YopI homologs. Specialized tools for transmembrane protein analysis (TMHMM, MEMSAT) are particularly relevant given YopI's potential membrane association suggested by its hydrophobic regions . For interpreting experimental data, resources like String-DB and IntAct provide protein-protein interaction networks that can contextualize new findings within the broader interactome.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.