Recombinant Bacillus subtilis Spore coat polysaccharide biosynthesis protein spsG (spsG)

Shipped with Ice Packs
In Stock

Description

Role in Spore Coat Formation

Bacillus subtilis forms endospores as a survival mechanism under nutrient-limiting conditions. These spores are encased in multiple protective layers, with the outermost layer known as the crust . While much attention has been given to the protein components of the spore crust (including CotVWXYZ and CgeA), the carbohydrate components are equally crucial for spore functionality .

The spsG protein plays a fundamental role in synthesizing the polysaccharide components of this protective coat. These carbohydrate structures contribute significantly to the physical and chemical properties of the spore surface, influencing characteristics such as hydrophobicity, resistance to environmental stressors, and interactions with biological surfaces .

Legionaminic Acid Biosynthesis Pathway

Perhaps the most significant discovery regarding spsG's function is its essential role in the biosynthesis of legionaminic acid (Leg) during sporulation. Research has conclusively demonstrated that the spsC, spsD, spsE, spsG, and spsM genes of Bacillus subtilis are required for Leg biosynthesis during the sporulation process .

Legionaminic acid is a nine-carbon backbone nonulosonic acid that decorates the spore surface. This sugar is particularly interesting as it is also found in the flagellin of human pathogens such as Helicobacter pylori and Campylobacter jejuni . The biosynthetic pathway involving spsG resembles the pseudaminic acid (Pse) biosynthetic pathway of Helicobacter pylori and the Leg biosynthetic pathway of Campylobacter jejuni, suggesting evolutionarily conserved mechanisms for producing these complex sugars .

In silico analysis using RaptorX software with the primary sequences of the SpsA-G and SpsM proteins has enabled researchers to construct a predictive biosynthetic pathway for legionaminic acid production in Bacillus subtilis . Within this pathway, spsG performs specific enzymatic functions that contribute to the stepwise synthesis of legionaminic acid precursors and their incorporation into the spore coat polysaccharides.

Impact on Spore Properties

The polysaccharide layer containing legionaminic acid produced through pathways involving spsG significantly affects various properties of the Bacillus subtilis spores. Research has shown that the sps gene products, including spsG, influence critical spore characteristics such as germination efficiency and surface hydrophobicity .

These properties are essential for spore survival, dispersal, and the eventual return to vegetative growth when environmental conditions improve. The specific glycosylation patterns created by the action of spsG and other enzymes may protect the spore from enzymatic degradation by predators or environmental factors, potentially containing rare sugars that resist common degradative enzymes .

Experimental Uses of Recombinant spsG

The availability of recombinant spsG protein enables various research applications aimed at understanding bacterial sporulation and carbohydrate biosynthesis. Primary applications include:

  1. Structure-function studies to elucidate the catalytic mechanism of spsG and its interactions with substrates

  2. Development of antibodies against spsG for immunological detection in various contexts

  3. In vitro enzymatic assays to characterize its biochemical activities

  4. Protein-protein interaction studies to map its relationships with other enzymes in the biosynthetic pathway

  5. Crystallographic studies to determine its precise three-dimensional structure

Researchers typically use recombinant spsG in SDS-PAGE applications to analyze protein expression, purification efficiency, and interactions with other molecules . The high purity of commercially available preparations (>90%) ensures reliable results in these experimental settings.

Significance in Understanding Bacterial Glycobiology

The study of spsG contributes significantly to our understanding of bacterial glycobiology, particularly the biosynthesis of complex sugars like nonulosonic acids. These sugars are relatively rare in bacteria compared to eukaryotes, making their presence in bacterial spores particularly intriguing .

The similarity between the legionaminic acid biosynthesis pathway in Bacillus subtilis and the pathways found in human pathogens suggests potential evolutionary relationships or conserved mechanisms for producing these specialized carbohydrates . This connection may provide insights into the roles of similar glycans in pathogenic bacteria and potential targets for antimicrobial interventions.

Furthermore, understanding the glycosylation of bacterial spores contributes to our knowledge of how bacteria protect themselves against environmental stressors and interact with their surroundings. The spore coat polysaccharide layer, to which spsG contributes, represents a sophisticated adaptation that enhances spore survival and functionality.

Reconstitution Protocol

When preparing recombinant spsG for experimental use, the following reconstitution protocol is recommended :

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation)

  4. Aliquot as needed for long-term storage

  5. Store according to the conditions outlined in section 4.1

This protocol ensures optimal solubilization while preserving protein stability for subsequent experimental applications.

Pathway Integration and Regulation

Further research is needed to fully characterize how spsG integrates with other enzymes in the legionaminic acid biosynthesis pathway. Understanding the temporal regulation of spsG expression during sporulation, its subcellular localization, and its coordination with other sps gene products would provide a more comprehensive picture of spore coat polysaccharide biosynthesis.

Biotechnological Applications

The enzymatic capabilities of spsG could potentially be harnessed for biotechnological applications, particularly in the synthesis of complex carbohydrates. Nonulosonic acids like legionaminic acid have potential applications in glycobiology research, vaccine development, and the production of bioactive glycoconjugates. Engineered variants of spsG might offer novel catalytic properties for specific synthetic applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
spsG; spsH; BSU37850; ipa-69d/ipa-70d; Spore coat polysaccharide biosynthesis protein SpsG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
spsG
Target Protein Sequence
MHVGIFADGGYEKGMGHVVRMKRLAEGLKQRCLITFYTNQDSEAFLHEEHWQVIVKPELQ QHEFILREIKSKKLDLLLFDILGAPAELLKKIKTETDAKIVLFEEKNGKSIQYSDAVING IYGDIRSRVYVQGNTRIYEGPDYLILHPAFQAAREDYTLKKDCRNILVALGGSDPKQLIF KVLAAADQVPDIKDKNMMFVMGSASPHQEAVRRRIEKKPQYKMIEQTNDMAGLMKQADAA IVAGGISLYEAICIGVPCLVLSQVEHQTATAKTFADQGAALDLGLGELVPDETLIYQMSR IMSSYPLRLSLHKGGRPLVDGKGIIRVTAILQDLYEQEI
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane.

Q&A

How is SpsG genetically organized within the B. subtilis genome?

SpsG is encoded within the spsABCDEFGHIJKL operon in the Bacillus subtilis genome. This gene cluster is dedicated to spore polysaccharide synthesis. According to the research data, the 3′ end of the spsF gene and the first 96 bp of the spsG coding sequence span approximately 679 bp that can be PCR amplified using specific primers . The genetic organization of the sps operon suggests coordinated expression during sporulation, with evidence indicating that the genes are expressed in the mother cell compartment during the late stages of sporulation under the control of specific sporulation sigma factors and transcriptional regulators .

What structural features characterize SpsG and related Sps proteins?

While the search results do not provide detailed structural information specifically about SpsG, comparative analysis suggests that the Sps proteins, including SpsG, function as glycosyltransferases and enzymes involved in glucose modification . The gene yfnH is reported to be paralogous to spsI (and ytdA) , suggesting potential structural or functional similarities among some components of the polysaccharide synthesis machinery. The specific domains and catalytic sites of SpsG would require further structural biology research, potentially involving crystallography or computational modeling approaches to determine its three-dimensional conformation and functional motifs.

What are the recommended methods for constructing spsG mutants in B. subtilis?

Based on the search results, several effective approaches for constructing spsG mutants in B. subtilis have been documented. One established method involves creating reporter fusions such as spsG::lacZ to study expression patterns . The procedure includes:

  • PCR amplification of a fragment spanning the 3′ end of the spsF gene and the first portion of the spsG coding sequence (approximately 679 bp)

  • Cloning the fragment into a vector like pGEM-T Easy

  • Excising the fragment by restriction enzyme digestion (e.g., EcoRI/BamHI)

  • Cloning upstream of a reporter gene (like lacZ) in an integrative vector (e.g., pJM783)

  • Transforming competent B. subtilis cells with the construct

  • Selecting recombinants through single reciprocal recombination (Campbell-like) at the spsG locus

For complete gene knockout, deletion mutations can be constructed using specialized vectors and marker replacement strategies. The search results mention that an additional sps null mutant was constructed by single crossover integration, which can serve as a template approach for targeting spsG specifically .

What techniques are most effective for analyzing SpsG expression patterns?

For analyzing SpsG expression patterns, several complementary techniques have proven effective:

  • Reporter gene fusions: Constructing spsG::lacZ fusions allows quantitative assessment of gene expression through β-galactosidase activity assays. This approach enables temporal tracking of expression during the sporulation process and can determine the effects of various regulatory mutations .

  • RT-qPCR assays: While not specifically mentioned for spsG in the search results, RT-qPCR has been used successfully to monitor expression of sporulation genes and could be applied to measure spsG transcript levels with appropriate primers .

  • Proteomics approaches: Label-free quantitative proteome analysis using LC-MS/MS can identify changes in protein levels, including spore coat proteins. This technique has been applied to analyze differential protein expression in spore-related mutants and could be adapted to study SpsG expression .

  • Western blotting: When specific antibodies are available, western blotting provides direct evidence of protein production and can detect post-translational modifications .

How can researchers effectively visualize and characterize the polysaccharide layer produced by SpsG?

The search results describe four complementary methods for visualizing and characterizing the polysaccharide layer involving SpsG:

  • Bacterial Adhesion to Hydrocarbons (BATH) assays: These measure the relative hydrophobicity of spores, which is directly affected by polysaccharide composition. Mutations in sps genes result in more hydrophobic spores due to reduced polysaccharide deposition .

  • India ink staining: This technique provides a simple visual assessment of the presence and extent of the polysaccharide layer .

  • Transmission Electron Microscopy (TEM) with ruthenium red staining: Ruthenium red specifically stains polysaccharides, allowing visualization of the polysaccharide layer's thickness and distribution. This technique has revealed that sps mutants lack a visible crust, while yfnH-D mutants exhibit an expanded polysaccharide layer with an unusual weblike morphology .

  • Scanning Electron Microscopy (SEM): Provides detailed surface morphology of spores, revealing changes in the outer spore layers resulting from mutations in polysaccharide synthesis genes .

How is spsG expression regulated during sporulation?

The regulation of spsG expression during sporulation appears to involve multiple sporulation-specific transcription factors. Although the search results don't provide complete details specifically for spsG, they mention that an spsA::lacZ fusion was used to transform competent cells of gerE, sigK, and gerR mutants . This suggests that these regulatory factors (GerE, SigK, and GerR) likely influence the expression of genes in the sps operon, including spsG.

The temporal expression pattern indicates that sps genes are expressed during the late stages of sporulation in the mother cell compartment, consistent with their role in synthesizing spore surface polysaccharides . The specific sigma factors involved in recognizing the sps operon promoters likely include the mother cell-specific sigma factor σK, with additional modulation by transcriptional regulators like GerE and GerR. A systematic analysis of spsG expression in various regulatory mutants would provide a comprehensive understanding of its regulation cascade during sporulation.

What is the precise biochemical role of SpsG in legionaminic acid biosynthesis?

According to the search results, SpsG is specifically required for legionaminic acid (Leg) biosynthesis during sporulation, along with other proteins encoded by the sps operon (SpsC, SpsD, SpsE, and SpsM) . Legionaminic acid is a nine-carbon backbone nonulosonic acid found on the spore surface of B. subtilis.

While the precise biochemical function of SpsG in this pathway is not explicitly detailed in the search results, we can infer from the classification of Sps proteins as glycosyltransferases and glucose modification enzymes that SpsG likely catalyzes a specific glycosyl transfer or modification step in the legionaminic acid biosynthetic pathway. The exact substrate, product, and reaction mechanism would require biochemical characterization through:

  • Purification of recombinant SpsG protein

  • In vitro enzymatic assays with potential substrates

  • Structural analysis of reaction products

  • Site-directed mutagenesis of putative catalytic residues

Given that legionaminic acid was previously known primarily in human pathogens like Helicobacter pylori , the discovery of this pathway in B. subtilis represents an important area for further biochemical investigation.

How do mutations in spsG affect spore surface properties compared to mutations in other sps genes?

The search results indicate that mutations in all genes of the sps operon result in similar phenotypic changes to spore surface properties . Specifically:

  • Increased hydrophobicity: All sps mutants produce spores that are more hydrophobic than wild-type, presumably due to reduced polysaccharide deposition on the spore surface .

  • Absence of visible crust: TEM with ruthenium red staining shows that sps mutants lack a visible crust layer, indicating the essential role of sps-encoded proteins, including SpsG, in establishing the polysaccharide component of the outermost spore layer .

Interestingly, the hydrophobic phenotype of sps mutant spores can be partially rescued by a second mutation inactivating any gene in the yfnHGF operon, suggesting a complex interplay between different polysaccharide synthesis pathways . This indicates that while SpsG and other Sps proteins are required for normal polysaccharide composition, alternative pathways may partially compensate when the primary pathway is disrupted.

For a comprehensive comparison of the effects of individual sps gene mutations, including spsG, a systematic study using identical analytical methods for each mutant would be necessary to detect subtle differences in phenotype that might indicate specific roles for each protein in the biosynthetic pathway.

How conserved is SpsG across different Bacillus species?

  • The search results mention that legionaminic acid, which requires SpsG for its biosynthesis in B. subtilis, was previously known to decorate the flagellin of human pathogens like Helicobacter pylori . This suggests that the biochemical pathway involving SpsG may have been acquired through horizontal gene transfer or evolved independently in different bacterial lineages.

  • The presence of paralogous genes (yfnH, spsI, and ytdA) suggests gene duplication events followed by functional specialization, a common evolutionary pattern in bacterial genomes.

A comprehensive analysis of SpsG conservation would require:

  • Sequence alignment of SpsG homologs across Bacillus species

  • Phylogenetic analysis to determine evolutionary relationships

  • Functional genomics studies to assess whether homologs retain the same function

  • Analysis of genomic context to determine if the operon structure is conserved

This type of analysis would provide insights into the evolutionary history of spore coat polysaccharide synthesis and potentially reveal adaptive patterns associated with different ecological niches.

What functional relationships exist between SpsG and other spore coat proteins?

The search results reveal several important functional relationships between SpsG (and other Sps proteins) and spore coat proteins:

  • Anchoring relationship with CgeA: The search results indicate that polysaccharides are anchored to the spore surface via the crust protein CgeA, specifically at threonine 112 (T112), which constitutes a probable O-glycosylation site . This suggests that while SpsG is involved in synthesizing the polysaccharide components, interactions with specific coat proteins like CgeA are essential for proper attachment to the spore surface.

  • Crust assembly relationship: The search results mention that "CgeA is located at the most downstream position in the crust assembly pathway" and that its N-terminal half is required for localization to the spore surface, while its C-terminal half is necessary for spore polysaccharide (SPS) addition . This suggests a sequential assembly process where CgeA must be properly localized before SpsG-dependent polysaccharides can be attached.

  • Interaction with crust proteins: The crust proteins CotVWXYZ and CgeA were all contained in the peeled SPS layer obtained from a strain missing CotE (the outer coat morphogenetic protein) , suggesting that SpsG-produced polysaccharides interact with multiple crust proteins.

These findings indicate a complex interplay between protein and polysaccharide components in spore coat assembly, with SpsG-dependent polysaccharides forming an integral part of a highly ordered macromolecular structure.

What are the common pitfalls in the expression and purification of recombinant SpsG?

While the search results don't directly address pitfalls specific to SpsG expression and purification, we can extrapolate from information about recombinant protein expression in B. subtilis to identify potential challenges:

  • Expression level optimization: The search results mention strategies to improve the expression level of recombinant proteins in B. subtilis using tandem promoters and promoter engineering . For recombinant SpsG expression, researchers might encounter low expression levels with standard promoters. Using dual-promoter systems such as P43-PHpaII, which increased nattokinase production by up to 109% , could potentially enhance SpsG expression.

  • Solubility issues: As a potential membrane-associated or hydrophobic protein involved in polysaccharide synthesis, SpsG might pose solubility challenges during expression and purification. Appropriate detergent selection and solubilization conditions would be critical.

  • Host strain selection: The search results mention using B. subtilis WB800 for recombinant protein expression . This strain has multiple protease gene deletions, which might be beneficial for SpsG expression to prevent degradation.

  • Functionality verification: Given SpsG's role in a complex biosynthetic pathway, verifying that recombinant SpsG retains enzymatic activity would require establishing appropriate biochemical assays.

To address these challenges, researchers should consider:

  • Testing multiple expression systems and promoter combinations

  • Exploring fusion tags to enhance solubility

  • Optimizing growth and induction conditions

  • Using protease-deficient host strains

  • Developing activity assays to confirm functional expression

How can researchers effectively differentiate between direct and indirect effects of spsG mutations?

Differentiating between direct and indirect effects of spsG mutations presents a methodological challenge. Based on the search results, several approaches can be employed:

  • Complementation studies: Reintroducing a functional copy of spsG into a mutant strain should restore the wild-type phenotype if the observed effects are directly due to the absence of SpsG. The search results mention different plasmid construction approaches that could be adapted for complementation studies .

  • Biochemical characterization: Purifying recombinant SpsG and demonstrating its specific enzymatic activity in vitro would provide direct evidence of its biochemical function. The observed phenotypes can then be correlated with the absence of this specific enzymatic activity.

  • Suppressor mutation analysis: The search results mention that "the hydrophobic phenotype from sps mutant spores was partially rescued by a second mutation inactivating any gene in the yfnHGF operon" . This approach of identifying suppressor mutations provides insights into functional relationships and can help distinguish direct from indirect effects.

  • Temporal gene expression control: Using inducible promoters to control when spsG is expressed during sporulation could help determine whether phenotypic effects are due to the absence of SpsG at specific developmental stages.

  • Comparative analysis: Systematically comparing phenotypes of single and combination mutants, as demonstrated in the search results where mutations in cgeD and the yfnH–D cluster were observed to expand the polysaccharide layer , can reveal genetic interactions that clarify direct versus indirect effects.

What technical challenges exist in characterizing the structure of SpsG-dependent polysaccharides?

Characterizing the structure of SpsG-dependent polysaccharides presents several technical challenges that researchers should be prepared to address:

What are the most promising approaches for engineering SpsG to create modified spore surface properties?

Based on the search results, several promising approaches for engineering SpsG to modify spore surface properties can be proposed:

  • Structure-guided mutagenesis: Once the structure-function relationship of SpsG is better understood, targeted mutations could alter the specificity or efficiency of the enzyme, potentially creating novel polysaccharide structures on the spore surface.

  • Promoter engineering: The search results discuss the use of tandem promoters to enhance protein expression in B. subtilis . Similar approaches could be applied to modulate spsG expression levels, potentially increasing polysaccharide deposition on the spore surface.

  • Domain swapping: Given that paralogs of some sps genes exist (e.g., yfnH, spsI, and ytdA) , domain swapping between these related proteins might generate enzymes with novel specificities or activities.

  • Integration with CgeA engineering: Since CgeA serves as the anchor protein for SpsG-dependent polysaccharides , co-engineering of both proteins could enable more controlled modification of spore surface properties. For example, introducing additional glycosylation sites in CgeA could increase polysaccharide density.

  • Heterologous pathway introduction: The identification of legionaminic acid in B. subtilis spores , previously known in pathogens like H. pylori, suggests that introducing additional heterologous polysaccharide biosynthesis pathways could further diversify spore surface properties.

These approaches could lead to engineered spores with modified adhesion properties, altered hydrophobicity, or novel recognition capabilities, potentially expanding their applications in biotechnology and research.

What are the implications of SpsG research for understanding sporulation across diverse bacterial species?

The research on SpsG and spore coat polysaccharides has several important implications for understanding sporulation more broadly:

  • Evolutionary insights: The presence of legionaminic acid, previously identified in pathogens like H. pylori , on B. subtilis spores suggests potential evolutionary connections or convergent evolution of similar surface modification strategies across diverse bacteria.

  • Environmental adaptation: The search results indicate that polysaccharides contribute to spore hydrophilicity, which helps with "the diffusion of spores in water-rich environments" . This suggests that SpsG-dependent surface modifications may represent adaptations to specific ecological niches.

  • Comparative sporulation biology: Understanding the role of SpsG in B. subtilis provides a framework for investigating similar proteins in other sporulating bacteria, potentially revealing conserved and divergent mechanisms of spore surface assembly.

  • Host-microbe interactions: Surface polysaccharides often mediate interactions with host organisms. Research on SpsG could provide insights into how spore surface polysaccharides might influence interactions between sporulating bacteria and their hosts or predators.

  • Biofilm formation: Although not directly mentioned in the search results, surface polysaccharides often play roles in biofilm formation. SpsG research might reveal connections between sporulation and biofilm-related processes in bacterial communities.

Future comparative studies across diverse sporulating species could reveal whether SpsG-like proteins represent a widespread strategy for spore surface modification or a specialized adaptation in certain lineages.

How might understanding SpsG function contribute to advances in synthetic biology applications?

Understanding SpsG function could contribute to several promising synthetic biology applications:

  • Engineered spore display systems: By understanding how SpsG-dependent polysaccharides interact with the spore surface, researchers could develop more sophisticated spore display systems for presentation of antigens, enzymes, or other functional molecules.

  • Controlled adhesion properties: The search results indicate that spore polysaccharides affect hydrophobicity and presumably adhesion properties . Engineering SpsG could allow creation of spores with tailored adhesion characteristics for applications in biosensors, biofilters, or controlled attachment to specific surfaces.

  • Glycoengineering platforms: The legionaminic acid pathway involving SpsG represents a potential platform for glycoengineering. Understanding and manipulating this pathway could enable production of novel glycoconjugates with applications in vaccine development or glycobiology research.

  • Robust protein display: The search results mention CgeA as an anchor protein for polysaccharides . This glycoprotein linkage mechanism could potentially be exploited to create more robust protein display systems that combine the stability of protein-polysaccharide interactions.

  • Environmental sensing and response: Engineering spore surface properties through SpsG modification could create environmentally responsive spores that change their properties (e.g., adhesion, aggregation) in response to specific conditions, potentially useful for environmental monitoring or remediation applications.

These applications would build upon the fundamental understanding of SpsG function to create novel biological tools and technologies with potential applications in medicine, environmental science, and industrial biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.