Recombinant Bacillus subtilis Spore germination protein A1 (gerAA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant GerAA

Recombinant GerAA is a 482-amino-acid protein (UniProt ID: P07868) expressed in E. coli with an N-terminal His tag for purification . Key properties include:

ParameterDetails
Molecular Weight~56 kDa (predicted)
Purity≥85–90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer
SolubilityRequires glycerol (5–50%) for long-term stability
Functional RoleGerminant receptor subunit in the inner spore membrane

Domain Architecture

  • N-Terminal Domain (NTD): Shares structural homology with substrate-binding proteins, featuring two αβα sandwich subdomains separated by a cleft implicated in germinant binding .

  • Central Transmembrane Domain: Contains 10–12 predicted membrane-spanning helices, including a conserved PFPP motif critical for conformational flexibility .

  • C-Terminal Domain: Interacts with GerAB and GerAC subunits to form a pentameric/hexameric ion channel in the inner membrane .

Germination Mechanism

GerAA functions within a heteromeric complex (GerAA-GerAB-GerAC) that acts as a nutrient-gated ion channel :

  1. Germinant Binding: L-alanine binds to the NTD, inducing conformational changes .

  2. Ion Release: The transmembrane helices form a cation-selective channel, releasing Ca²⁺-DPA from the spore core .

  3. Cortex Hydrolysis: Ion flux activates cortex-lytic enzymes, initiating germination .

Functional Mutational Analysis

Site-directed mutagenesis studies reveal critical residues for GerAA activity :

MutationPhenotypeImplication
P324S10-fold increased sensitivity to L-alanineAltered hinge flexibility enhances germinant responsiveness
P326SSpontaneous phase-dark spores ("quasigerminated" state)Constitutive receptor activation
G398STemperature-sensitive germination defectDisrupted interhelical loop stability
N146A/H304ALoss of GerAC stability; abolished germinationCompromised receptor assembly

Research Applications

  • Germination Studies: Elucidating ligand specificity and ion channel dynamics .

  • Structural Biology: Cryo-EM and crystallography to resolve receptor architecture .

  • Antibiotic Development: Targeting GerAA to inhibit pathogenic spore germination (e.g., B. anthracis) .

Challenges and Future Directions

  • Structural Resolution: Conflicting models (pentamer vs. hexamer) necessitate cryo-EM validation .

  • Germinant Binding Site: Precise molecular interactions remain undefined .

  • Therapeutic Targeting: Engineering small-molecule inhibitors against GerAA’s NTD .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
gerAA; gerA1; BSU33050; Spore germination protein A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-482
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
gerAA
Target Protein Sequence
MEQTEFKEYIHDNLALVLPKLKENDDLVKNKKMLANGLVFYYLYFSEMTDENKVSEAIKT LIKDEETLTLDQVKKRLDQLDARPVETAKKTIESILNGNCAVFINGLDKAYILTTGKKKT RSLTEPTTEKVVRGPKVAFVEDIDTNLALIRQRTSHPKLITKKIMIGENKLKPAAIMYIE GKAKKSVIKEVKARLKNIQLEDIQDSGTLEELIEDNKYSPFPQIQNTERPDKVSSALFNG RVAILVDSSPFVLLVPVSLGILMQSPDDYYERWISASLIRSLRFASIFITLFLSSIYITL VSFHQGLLPTALAVTISANRENVPFPPIFEALLMEVTIELLREAGLRLPNPLGQTIGLVG GVVIGQAAVEANLVSSILVIVVSVIALASFTVPQYGMGLSFRVLRFISMFSAAILGLYGI ILFMLVVYTHLTRQTSFGSPYFSPNGFFSLKNTDDSIIRLPIKNKPKEVNNPNEPKTDST ET
Uniprot No.

Target Background

Function
Forms a complex at the inner spore membrane that acts as a receptor for L-alanine, thus playing a role in stimulating germination in response to alanine. It can stimulate germination in the absence of GerD and GerK gene products (fructose and glucose receptors, respectively), but the response is enhanced in their presence.
Database Links
Protein Families
GerABKA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of GerAA protein in Bacillus subtilis spore germination?

GerAA is a key component of the GerA germination receptor complex located in the inner membrane of Bacillus subtilis spores. This protein helps detect specific nutrient germinants in the environment and initiates the cascade of events leading to spore germination. When nutrients bind to the GerA receptor complex, it triggers the release of monovalent cations and the spore core's large depot of Ca-dipicolinic acid (CaDPA), initiating the germination process .

The GerA receptor appears to be highly sensitized, responding to even minor fluctuations in nutrient levels. This sensitivity comes with a biological cost, as up to 8% of sporulating cells may trigger premature germination, resulting in non-viable spores . This suggests that the GerAA protein's function must be precisely regulated to ensure appropriate timing of germination.

How does the GerA receptor complex assemble during sporulation?

The GerA receptor complex assembles in the inner membrane of the developing spore during the sporulation process. Assembly occurs in a coordinated manner as the forespore matures and the protective layers of the spore form. Research suggests that proper assembly is crucial for subsequent germination functionality .

Several sporulation mutants with defects in spore protective layer assembly show exacerbated phenotypes in the presence of a functional GerA receptor, suggesting an interplay between spore morphogenesis and receptor assembly . This interaction indicates that the timing and localization of GerA receptor complex assembly, including the GerAA protein, must be precisely controlled during spore formation to prevent premature germination.

What experimental approaches are used to study GerAA expression and localization?

Several experimental approaches can be employed to study GerAA expression and localization:

  • Fluorescent protein fusions: Creating GerAA-GFP fusion proteins to visualize the localization of GerAA during sporulation and germination using fluorescence microscopy.

  • Immunolocalization: Using antibodies specific to GerAA to detect the protein in fixed spores at different developmental stages.

  • Western blotting: Quantifying GerAA protein levels during sporulation and germination.

  • Fractionation studies: Isolating different spore compartments (coat, cortex, inner membrane) to determine the precise localization of GerAA.

  • Time-course experiments: Analyzing the expression and localization of GerAA at different time points during sporulation to understand the temporal regulation of receptor assembly.

When designing these experiments, researchers should consider the heterogeneity in individual spore behavior, as germination rates can vary significantly within populations . This heterogeneity may mask important aspects of GerAA function when only population-based measurements are used.

How do mutations in gerAA affect the sensitivity and specificity of nutrient recognition?

Mutations in the gerAA gene can significantly alter the sensitivity and specificity of nutrient recognition by the GerA receptor complex. Research approaches to study these effects include:

  • Site-directed mutagenesis: Creating specific point mutations in conserved domains of gerAA to identify key residues involved in nutrient binding and signal transduction.

  • Germination assays with mutant strains: Comparing the germination rates of wild-type and gerAA mutant spores in response to various concentrations of known germinants.

  • Competition assays: Using structural analogs of germinants to assess changes in binding specificity resulting from mutations.

  • Single-spore analysis: Employing techniques such as differential interference contrast (DIC) microscopy and Raman spectroscopy to monitor germination events in individual spores, particularly CaDPA release, which provides insights into the functional consequences of gerAA mutations .

Studies have shown that loss-of-function mutations in the GerA receptor can partially suppress the phenotypes of over 25 sporulation mutants, indicating the complex interplay between GerA functionality and spore formation . This suggests that gerAA mutations may have pleiotropic effects beyond simply altering germination efficiency.

What is the relationship between GerAA and the SpoVA proteins in controlling CaDPA release?

The relationship between GerAA (as part of the GerA receptor complex) and SpoVA proteins in controlling CaDPA release represents a complex signaling pathway in spore germination. GerA receptors detect nutrients and trigger initial germination events, while SpoVA proteins appear to be directly involved in CaDPA release from the spore core .

Experimental approaches to study this relationship include:

  • Genetic interaction studies: Creating strains with combinations of mutations in gerAA and spoVA genes to identify epistatic relationships.

  • Analysis of CaDPA release kinetics: Using Raman spectroscopy to monitor CaDPA release in individual spores with various genetic backgrounds (wild-type, gerAA mutants, spoVA mutants, and double mutants) .

  • Protein-protein interaction studies: Employing techniques such as bacterial two-hybrid assays, co-immunoprecipitation, or FRET to detect potential physical interactions between GerAA and SpoVA proteins.

Research has shown that spores with elevated levels of SpoVA proteins germinate faster than wild-type spores, while mutations in spoVA result in slower germination . This suggests that SpoVA proteins may be rate-limiting factors in the germination process initiated by GerA receptor activation.

Spore TypeGermination Rate at 25°CGermination Rate at 45°CCaDPA Release Pattern
Wild-typeModerateFastStandard reference
↑SpoVAFaster than wild-typeFaster than wild-typeEnhanced release
gerDVery slow (≤10% in 2h)SlowDelayed release
spoVA1Slower than wild-typeModerately slowAltered release
spoVA2Slower than wild-typeModerately slowAltered release

Table 1: Comparative germination rates and CaDPA release patterns of different B. subtilis spore types based on data from reference

How do experimental conditions affect recombinant GerAA expression and functionality?

When expressing recombinant GerAA in B. subtilis, several experimental conditions can significantly impact protein expression and functionality:

  • Promoter selection: Using appropriate promoters for controlled expression during sporulation is critical. Strong constitutive promoters may lead to premature GerAA expression, potentially disrupting normal sporulation.

  • Secretion signals: If attempting to produce secreted forms of GerAA, the choice of secretion signal can dramatically affect protein yields due to bottlenecks in the secretion pathway of B. subtilis .

  • Protease concerns: B. subtilis naturally secretes multiple proteases that can degrade recombinant proteins. Using protease-deficient strains (lacking up to ten different proteases) can improve protein stability, though this may not completely eliminate degradation issues .

  • Growth and sporulation conditions: Temperature, media composition, and timing of induction can all affect both the quantity and proper folding of recombinant GerAA.

  • Tag selection: If GerAA is tagged for purification or detection, the position and nature of the tag must be carefully considered to avoid disrupting protein function, particularly since GerAA is a membrane protein.

When designing expression systems, researchers should consider that B. subtilis has GRAS (Generally Recognized as Safe) status from the FDA and QPS (Qualified Presumption of Safety) status from EFSA, making it advantageous for certain applications .

What controls are essential when designing experiments to study GerAA-mediated germination?

When designing experiments to study GerAA-mediated germination, several controls are essential:

  • Genetic controls:

    • Wild-type strains (positive control for normal germination)

    • Complete gerA null mutants (negative control for GerA-dependent germination)

    • Complemented gerAA mutants (verifying phenotype specificity)

    • Strains with mutations in other germination receptors (e.g., gerB, gerK) to control for pathway specificity

  • Germination condition controls:

    • Non-nutrient germination inducers (e.g., dodecylamine) that bypass GerA receptors

    • Various concentrations of L-alanine to assess dose-dependent responses

    • Different temperature conditions, as germination rates are temperature-dependent

  • Analytical controls:

    • Internal standards for protein quantification

    • Controls for microscopy and spectroscopy techniques (e.g., baseline Raman spectra of dormant spores)

    • Time-matched sampling to account for sporulation heterogeneity

When analyzing results, researchers should remember that germination rates of individual spores in populations are extremely heterogeneous, and population-level measurements may mask this heterogeneity . Therefore, single-spore analysis techniques should be considered alongside population-based approaches.

How should researchers design experiments to study the interaction between GerAA and other components of the germination machinery?

Designing experiments to study interactions between GerAA and other germination components requires careful planning:

  • Genetic approaches:

    • Construct strains with mutations in multiple germination genes to identify genetic interactions

    • Use suppressor screens to identify proteins that interact functionally with GerAA

    • Create chimeric proteins between different Ger receptors to identify specificity-determining regions

  • Biochemical approaches:

    • Develop membrane extraction protocols that preserve protein-protein interactions

    • Use crosslinking agents to capture transient interactions during germination

    • Perform co-immunoprecipitation with GerAA-specific antibodies

  • Structural biology approaches:

    • Pursue cryo-electron microscopy of the intact GerA complex

    • Use NMR or X-ray crystallography for structural analysis of GerAA domains

  • Live-cell imaging:

    • Develop dual-labeled systems to visualize GerAA and potential interaction partners during germination

    • Use FRET or BRET to detect proximity between proteins in living spores

  • Variable manipulation:

    • Systematically manipulate independent variables (e.g., protein expression levels, germinant concentrations)

    • Control extraneous variables such as temperature, pH, and media composition

    • Use true experimental designs with proper controls and randomization

These experimental approaches should be designed to test specific hypotheses about GerAA interactions, following the formal steps of hypothesis development, variable definition, and systematic manipulation described in experimental design literature .

What methodologies are most effective for analyzing contradictions in GerAA research data?

When analyzing contradictions in GerAA research data, several methodologies can be effective:

  • Meta-analysis approaches:

    • Systematically review published literature on GerAA

    • Identify methodological differences that might explain contradictory results

    • Perform statistical analysis of pooled data when possible

  • Experimental verification:

    • Replicate contradictory findings under identical conditions

    • Systematically vary one parameter at a time to identify the source of discrepancies

    • Use multiple analytical techniques to verify the same result

  • Single-spore analysis:

    • Apply techniques like DIC microscopy and Raman spectroscopy to analyze individual spores rather than populations

    • Characterize the distribution of behaviors rather than just average responses

    • Identify subpopulations that might explain apparently contradictory results

  • Quality control measures:

    • Implement rigorous strain verification protocols

    • Standardize experimental conditions across laboratories

    • Develop shared reference materials and protocols

  • Statistical approaches:

    • Use appropriate statistical tests for the data distribution

    • Consider Bayesian analysis for integrating prior knowledge with new data

    • Implement techniques for handling outliers and heterogeneous data

Contradictions in data are often valuable indicators of underlying complexity in biological systems . For example, the observation that GerA can trigger premature germination in a subset of sporulating cells suggests a stochastic element to GerA activation that might explain apparently contradictory results in different experimental settings .

What are the best methods for producing functional recombinant GerAA protein for in vitro studies?

Producing functional recombinant GerAA protein presents significant challenges due to its membrane-associated nature. Here are recommended approaches:

  • Expression system selection:

    • Consider using B. subtilis itself as an expression host due to its native membrane composition and protein folding machinery

    • Alternative Gram-positive hosts like Lactococcus lactis might offer advantages due to their non-proteolytic nature

    • If using E. coli, specialized strains designed for membrane protein expression may be necessary

  • Construct design:

    • Include native membrane-targeting sequences

    • Consider fusion partners that enhance membrane insertion and stability

    • Design constructs allowing for controlled induction during late-exponential growth phase

  • Solubilization and purification:

    • Optimize detergent selection for membrane extraction (test multiple options: DDM, LMNG, etc.)

    • Use affinity chromatography under conditions that maintain protein structure

    • Consider nanodiscs or liposomes for maintaining protein in a membrane-like environment

  • Functional verification:

    • Develop in vitro assays to verify ligand binding activity

    • Use circular dichroism or other structural techniques to confirm proper folding

    • If possible, reconstitute with other GerA complex components to assess complex formation

How can researchers accurately measure GerAA-mediated changes during the germination process?

Accurate measurement of GerAA-mediated changes during germination requires sophisticated techniques that can detect rapid biochemical and biophysical alterations:

  • Real-time measurement techniques:

    • Raman spectroscopy to monitor CaDPA release from individual spores during germination

    • Differential interference contrast (DIC) microscopy to track changes in spore refractility

    • Fluorescence assays using ion-sensitive dyes to detect ion movements

    • Real-time PCR for monitoring gene expression changes during outgrowth

  • Biochemical assays:

    • Quantification of DPA release using colorimetric assays

    • Measurement of ATP production during early outgrowth

    • Enzymatic assays to track activation of cortex lytic enzymes

  • Single-spore techniques:

    • Microfluidic devices combined with time-lapse microscopy

    • Flow cytometry with germination-specific markers

    • Single-spore RNA sequencing for transcriptional profiling

  • Data analysis approaches:

    • Kinetic modeling of germination phases

    • Population heterogeneity analysis

    • Correlation analysis between different germination parameters

Studies have shown that wild-type spore populations germinate slower than spores with elevated SpoVA protein levels, while gerD spores germinate much slower than wild-type spores . This heterogeneity underscores the importance of single-spore analysis techniques for accurately characterizing the germination process.

Germination ParameterMeasurement TechniqueAdvantagesLimitations
CaDPA releaseRaman spectroscopyReal-time, single-spore resolutionSpecialized equipment required
Spore refractilityDIC microscopySimple, non-invasiveIndirect measure of germination
Ion fluxesIon-selective electrodesHighly specificLimited spatial resolution
Cortex hydrolysisCortex fragment analysisDirect measure of enzymatic activityLow temporal resolution
Gene expressionRNA-seqGenome-wide coverageDestructive sampling

Table 2: Techniques for measuring different parameters during GerAA-mediated germination

What computational approaches can enhance analysis of GerAA structure-function relationships?

Computational approaches offer powerful tools for analyzing GerAA structure-function relationships:

  • Structural modeling:

    • Homology modeling based on related proteins with known structures

    • Ab initio modeling for unique domains

    • Molecular dynamics simulations to predict dynamic behavior in membranes

    • Protein-ligand docking to predict germinant binding sites

  • Sequence analysis:

    • Multiple sequence alignment across diverse bacteria to identify conserved residues

    • Evolutionary analysis to detect selection pressure on different domains

    • Coevolution analysis to predict residue interactions

    • Functional domain prediction and mapping

  • Network analysis:

    • Protein-protein interaction network modeling

    • Signal transduction pathway mapping

    • Integration of germination regulatory networks with structural data

  • Machine learning approaches:

    • Prediction of mutation effects on protein function

    • Pattern recognition in germination kinetics data

    • Classification of germination phenotypes

    • Integration of multiple data types for comprehensive modeling

  • Visualization tools:

    • 3D visualization of protein structures and complexes

    • Interactive exploration of structure-function relationships

    • Integration of experimental data with structural models

These computational approaches should be validated with experimental data whenever possible, using an iterative process of prediction, testing, and refinement to build increasingly accurate models of GerAA function.

What are the emerging technologies that could advance GerAA research?

Several emerging technologies hold promise for advancing GerAA research:

  • Cryo-electron microscopy (Cryo-EM):

    • High-resolution structural analysis of the complete GerA receptor complex

    • Visualization of conformational changes during germinant binding

  • CRISPR-Cas9 genome editing:

    • Precise modification of gerAA sequences in situ

    • Creation of large libraries of gerAA variants for functional screening

    • Implementation of CRISPRi for tunable gene expression

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to track conformational changes

    • Single-molecule force spectroscopy to measure protein-ligand interactions

    • Super-resolution microscopy to visualize receptor clustering

  • Microfluidics:

    • High-throughput screening of germination responses

    • Precise control of the microenvironment around individual spores

    • Time-resolved sampling for biochemical analysis

  • Synthetic biology approaches:

    • Creation of minimal germination systems in heterologous hosts

    • Engineering of novel germination specificities

    • Development of germination-based biosensors

  • Multi-omics integration:

    • Combining proteomics, transcriptomics, and metabolomics for systems-level understanding

    • Temporal profiling throughout the germination process

    • Single-spore multi-omics to address heterogeneity issues

These technologies could help overcome current limitations in understanding the molecular mechanisms of GerAA function and its role in coordinating the germination response.

How might understanding GerAA function contribute to broader applications in synthetic biology?

Understanding GerAA function could contribute to several synthetic biology applications:

  • Engineered germination systems:

    • Design of spores with precisely controlled germination triggers

    • Creation of logical AND/OR gates for germination requiring multiple inputs

    • Development of time-delayed germination circuits

  • Biosensing applications:

    • Engineering GerAA variants to detect non-natural compounds

    • Creating spore-based sensors for environmental monitoring

    • Developing diagnostic tools based on germination responses

  • Therapeutic applications:

    • Designing probiotics that germinate only under specific gut conditions

    • Creating therapeutic delivery systems that release compounds upon germination

    • Developing targeted antimicrobials that exploit germination pathways

  • Industrial biotechnology:

    • Engineering spores for timed release of enzymes in industrial processes

    • Creating self-activating biocatalysts for specific environmental conditions

    • Developing bioremediation systems that activate only in the presence of target pollutants

The GerA receptor's natural sensitivity to specific nutrients, coupled with its "poised on a knife's edge" behavior , suggests that it could be engineered to create highly responsive biological switches for various applications.

What are the key challenges in translating basic GerAA research to applied biotechnology?

Translating basic GerAA research to applied biotechnology faces several key challenges:

  • Protein engineering challenges:

    • Maintaining stability while altering specificity

    • Ensuring proper membrane integration in different expression systems

    • Achieving consistent performance across different conditions

  • Regulatory considerations:

    • Navigating regulatory frameworks for engineered bacterial spores

    • Addressing potential biosafety concerns

    • Leveraging the GRAS status of B. subtilis while introducing modifications

  • Scale-up considerations:

    • Developing economically viable production processes

    • Ensuring batch-to-batch consistency

    • Maintaining stability during storage and application

  • Performance optimization:

    • Reducing heterogeneity in germination responses

    • Improving signal-to-noise ratio in sensing applications

    • Enhancing specificity to prevent false positives

  • Integration challenges:

    • Incorporating engineered germination systems into existing industrial processes

    • Developing appropriate formulations for different applications

    • Ensuring compatibility with other biological and chemical components

  • Intellectual property landscape:

    • Navigating existing patents on B. subtilis germination systems

    • Developing patentable modifications with clear novelty

    • Balancing open science and commercial development

Addressing these challenges will require interdisciplinary collaboration between protein engineers, synthetic biologists, process engineers, and regulatory experts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.