Recombinant Bacillus subtilis Spore germination protein B1 (gerBA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bacillus subtilis Spore Germination Protein B1 (GerBA)

Recombinant Bacillus subtilis spore germination protein B1 (GerBA) is a His-tagged recombinant protein derived from the gerB operon, which encodes components of a germinant receptor complex critical for spore germination. This protein is produced in heterologous systems such as E. coli or yeast, with applications in research and biotechnology .

Functional Role

  • Germinant Recognition: Binds l-amino acids (e.g., l-asparagine) in conjunction with GerK and cogerminants .

  • Signal Transduction: Triggers Ca²⁺-DPA release and cortex hydrolysis via downstream effectors like SleB and CwlJ .

Role in Spore Germination

GerBA is essential for nutrient-triggered germination but not for chemical germination (e.g., Ca²⁺-DPA chelate) . Key findings include:

Cooperative Germination Mechanisms

Germinant ReceptorGerminant/CogerminantRole of GerBA
GerB + GerKAGFK (l-asparagine, glucose, fructose, K⁺)Critical for binding and signaling
GerB Variants*l-amino acids (e.g., l-alanine)Alone sufficient for germination in mutant strains
GerAl-alanine, l-valineNo direct interaction; independent pathways

Key Findings

  • GerB Dependency: Deletion of gerBA or gerBB abolishes AGFK-induced germination .

  • Genetic Interactions: Overexpression of GerB increases germination rates but suppresses activity of other receptors (e.g., GerA) .

  • Structural Adaptations: Mutations in GerBA (e.g., GerB*) enable independent germination with l-amino acids without GerK .

Mutational Analysis

Studies using gerBA mutants reveal:

  1. Gain-of-Function Mutations: GerB* variants (e.g., gerBA mutants) enable germination with d-alanine or l-amino acids .

  2. Loss-of-Function Mutations: ΔgerBA spores fail to germinate in AGFK but respond normally to GerA-dependent germinants .

Localization and Clustering

  • Subcellular Localization: GerBA clusters in the spore inner membrane with GerD and GerK, forming "germinosomes" .

  • Dependence on Lipid Modification: Diacylglycerol addition to GerD is required for clustering .

Production Systems

ParameterE. coliYeast
YieldHighModerate
Purity>80% (via Ni-NTA affinity)Requires additional purification
CostLowerHigher
Use CaseStructural studies, ELISA kitsComplex post-translational modifications

Applications

  • Research Tools: ELISA kits for detecting GerBA in spore lysates .

  • Biotechnology: Expression systems for producing germinant receptors in GRAS-certified hosts like B. subtilis .

Critical Research Gaps and Future Directions

  1. Mechanistic Insights: How GerBA distinguishes between l-alanine and l-valine in GerA-mediated germination.

  2. Structural Dynamics: Cryo-EM studies to resolve GerBA-GerK interactions.

  3. Industrial Applications: Engineering B. subtilis for high-yield GerBA production using inducible promoters .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please contact us in advance for arrangement and associated fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is decided during production. If you require a particular tag, please communicate your preference and we will prioritize its implementation if feasible.
Synonyms
gerBA; BSU35800; Spore germination protein B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-483
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
gerBA
Target Protein Sequence
MQIDSDLQNNLDTLKKTLGQNDDMMFYTFAFGDSRQKACLLYIDGLTENKMLAQYVISPL QKEALAHKECSIEDLSAFFFGFHHSVVSTMKEIEQLVFSGQAILLADGYRGGLAFDTKSV ATRSLDEPSSEVVERGPKIGFIEKLRTNTALLRERTSDPNLVIKEMTLGKRTKKKIAVAY IQDIAPDYVVKEVFKRLKSVNIDNLPESGTLEQLIEDEPFSIFPTILSTERPDRVESSLL EGRVSILVDGTPFALIVPATVDEFIHSPDDYSQRWIPMSLVRLLRYSSILITIYLPGLYI SLVSFHTGLLPTRMAISIAGSRLNVPFPPFVEAFIMIFTIELIREAGLRLPKPIGQTIGL IGGVVIGQAAVQAQIVSALMVIVVSVTALASFTVPSYAYNFPLRIIRIGVMISATALGMY GVIMVYLFVIGHLMRLKSFGQDYIIPIMAQPGQDLKDTVIRIPTMFLKRRPTRNDPEDNI RQR
Uniprot No.

Target Background

Function
This protein participates in the response to the germinative mixture of L-asparagine, glucose, fructose, and potassium ions (AGFK). It cannot stimulate germination independently and requires the presence of gerD and gerK gene products, which serve as receptors for fructose and glucose respectively.
Database Links
Protein Families
GerABKA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the gerBA protein and what role does it play in Bacillus subtilis spore germination?

gerBA is one of three essential subunits (gerBA, gerBB, and gerBC) that constitute the GerB germinant receptor in Bacillus subtilis spores. As part of the GerB receptor complex, gerBA is responsible for recognizing specific small molecule nutrients (germinants) that trigger the germination process in dormant spores. This protein plays a crucial role in the signal transduction pathway that initiates the conversion from metabolically dormant spores to actively growing cells. The GerB receptor is homologous to the more extensively studied GerA receptor, which recognizes L-alanine as its primary germinant .

The functional importance of gerBA has been demonstrated through genetic studies where mutations in the gerBA gene altered germination specificity. For instance, dominant mutations in the gerBA gene have been identified that allow spores to respond to novel germinants such as D-alanine, which wild-type spores cannot recognize as a germination signal . This suggests that gerBA is likely involved in germinant binding or the initial steps of signal transduction during germination.

How does gerBA differ from other germination proteins in the Bacillus subtilis germination machinery?

gerBA belongs to a family of homologous proteins that include gerAA and gerKA, which are components of different germinant receptors in B. subtilis. While these proteins share structural similarities, they differ in their germinant specificity. The GerA receptor (containing gerAA) responds primarily to L-alanine, while the GerB receptor (containing gerBA) typically responds to a combination of amino acids and sugars .

Unlike the membrane-spanning GerBB protein, which based on homology to GerAB likely forms a channel structure, gerBA is believed to function as the substrate recognition component of the receptor complex. This functional differentiation is evident from studies of the GerA receptor, where GerAB forms a water channel crucial for water uptake during germination, while GerAA likely participates in germinant recognition . The GerB receptor components work together synergistically, as all three subunits are required for functional germinant recognition and the initiation of germination .

What are the key structural features of the gerBA protein that enable its function?

While detailed structural information specific to gerBA is limited in the provided search results, inferences can be made based on studies of the homologous gerAA protein. The gerBA protein likely contains domains involved in germinant binding and interaction with other receptor subunits. The protein may possess specific binding pockets that recognize molecular features of its cognate germinants.

Based on studies of the GerA receptor complex, gerBA likely interacts closely with gerBB and gerBC to form a functional receptor unit. This interaction is essential for proper signal transduction following germinant binding. Structural predictions using tools like AlphaFold may reveal important structural features of gerBA, similar to how such approaches have been used to study GerAB . The ability of certain mutations in gerBA to alter germinant specificity suggests the presence of critical amino acid residues that directly participate in germinant recognition or that affect the conformational changes necessary for signal transduction .

How do mutations in gerBA affect the germinant specificity of Bacillus subtilis spores?

Research has revealed that specific mutations in the gerBA gene can dramatically alter the germinant recognition profile of B. subtilis spores. Most notably, dominant mutations in gerBA have been identified that enable spores to germinate in response to D-alanine, a compound that does not trigger germination in wild-type spores . This gain-of-function phenotype suggests that gerBA plays a direct role in germinant recognition and that alterations to its structure can modify its binding specificity.

These findings have significant implications for understanding the molecular basis of germinant recognition. By analyzing the specific amino acid changes in these mutants and correlating them with the altered germination responses, researchers can identify critical residues involved in germinant binding or signal transduction. For example, if the mutations occur in putative binding pockets, this would support the hypothesis that gerBA directly interacts with germinants. Alternatively, if the mutations are located at protein-protein interfaces, they might affect how gerBA communicates with other receptor subunits following germinant binding .

Comprehensive mutational analysis of gerBA, combined with functional germination assays, can provide a detailed map of structure-function relationships within this protein. This approach has been successfully applied to the related GerAB protein, where specific residues (Y97, L199, F342) were identified as critical for germination in response to L-alanine .

What are the molecular mechanisms of signal transduction following germinant binding to the GerB receptor?

The molecular events that follow germinant binding to the GerB receptor remain incompletely understood, but research on the homologous GerA receptor provides valuable insights. Upon germinant binding to the receptor complex, a series of conformational changes likely occurs that triggers the initial events of germination. In the case of the GerA receptor, evidence suggests that GerAB forms a water channel that facilitates water influx into the spore core, a critical early step in germination .

By analogy, gerBB (the homolog of GerAB in the GerB receptor) may form a similar channel structure. The binding of germinants to gerBA potentially induces conformational changes in the receptor complex that activate this channel. This activation would then allow water movement into the spore, initiating the rehydration of the spore core and subsequent degradation of the spore cortex. The increase in core water content is a crucial step in transitioning from the metabolically dormant state (~25-45% water content) to the ~80% water content of growing cells .

Recent molecular dynamics simulation studies of GerAB have provided evidence for water channel formation and identified key residues that regulate water passage. Similar approaches could be applied to study gerBB and its interaction with gerBA to understand how germinant binding leads to channel activation .

How does the oligomeric state of the GerB receptor affect its function, and what role does gerBA play in receptor assembly?

The functional GerB receptor likely exists as an oligomeric complex, with multiple copies of the gerBA, gerBB, and gerBC subunits assembling into a larger structure. Research on the related GerA receptor suggests that it forms an oligomeric membrane channel that releases monovalent cations upon sensing L-alanine . By extension, the GerB receptor may adopt a similar quaternary structure.

gerBA likely plays a crucial role in the assembly and stability of this oligomeric complex. Interactions between gerBA and the other receptor subunits (gerBB and gerBC) are essential for forming a functional receptor. Mutations in gerBA that affect these protein-protein interactions could disrupt receptor assembly or alter its functional properties without necessarily changing germinant binding directly.

Understanding the oligomeric structure of the GerB receptor and gerBA's role in this assembly requires advanced structural biology techniques such as cryo-electron microscopy or X-ray crystallography. Additionally, protein-protein interaction studies using techniques like co-immunoprecipitation or FRET (Fluorescence Resonance Energy Transfer) could reveal how gerBA interacts with the other receptor subunits in the native membrane environment .

What are the optimal expression systems for producing recombinant gerBA protein?

Expressing recombinant gerBA protein presents several challenges due to its likely membrane association and potential toxicity when overexpressed. Based on approaches used for similar proteins, several expression systems can be considered:

Bacillus subtilis Expression System: Using B. subtilis itself as an expression host offers advantages of proper protein folding and potential association with native interaction partners. The genetic recombination approach used in spore surface display technology could be adapted for gerBA expression . This system allows for the integration of the recombinant gene into the B. subtilis genome, enabling expression during sporulation when the native gerBA would normally be expressed.

E. coli Expression System with Solubility Tags: For biochemical and structural studies requiring larger protein quantities, E. coli expression systems with solubility-enhancing tags (such as MBP, SUMO, or TrxA) can be employed. These tags may help prevent aggregation of the recombinant gerBA and facilitate purification through affinity chromatography.

For both systems, expression conditions must be carefully optimized, considering variables like temperature, inducer concentration, and expression duration. Lower temperatures (16-25°C) and mild induction conditions often favor proper folding of complex membrane-associated proteins. Purification strategies should account for the potential membrane association of gerBA, possibly requiring detergent solubilization steps .

How can researcher design experiments to study the interaction between gerBA and its germinants?

Studying the interaction between gerBA and its germinants requires specialized approaches that account for the membrane context of the protein and the specificity of the interactions. Several methodological strategies can be employed:

Germination Assays with Mutant Strains: A foundational approach involves creating B. subtilis strains with specific mutations in the gerBA gene and assessing how these mutations affect germination responses to various compounds. This approach was successfully used to identify dominant mutations in gerBA that allowed spores to germinate in response to D-alanine . Germination can be monitored through changes in optical density (as spores lose refractility during germination), release of dipicolinic acid, or staining properties.

Binding Assays with Purified Protein: To directly measure germinant binding, researchers can develop in vitro binding assays using purified recombinant gerBA (potentially in complex with gerBB and gerBC). Techniques such as surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), or fluorescence-based binding assays can quantify binding affinities and kinetics. These methods require careful design of the protein construct and the experimental conditions to maintain protein activity.

Computational Approaches: Molecular docking and molecular dynamics simulations can provide insights into the structural basis of germinant recognition. These in silico approaches require a high-quality structural model of gerBA, which might be generated through homology modeling based on related proteins or predicted using methods like AlphaFold. Similar approaches have been used to study water channel formation in GerAB and could be adapted for gerBA-germinant interactions .

What methodologies are most effective for studying the structural changes in gerBA during spore germination?

Capturing the dynamic structural changes in gerBA during germination presents significant technical challenges but can be approached using several complementary methods:

Time-resolved Spectroscopic Techniques: FRET (Fluorescence Resonance Energy Transfer) or EPR (Electron Paramagnetic Resonance) spectroscopy can detect conformational changes in gerBA during germinant binding and subsequent activation. These approaches require strategic labeling of the protein with fluorescent or paramagnetic probes at positions that undergo significant movement during activation.

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify regions of gerBA that become more exposed or protected during germinant binding or receptor activation. By comparing the deuterium uptake patterns in the presence and absence of germinants, researchers can map the structural dynamics of the protein.

Steered Molecular Dynamics (SMD) Simulations: As demonstrated with GerAB, computational simulations can provide valuable insights into protein dynamics during functional processes. SMD simulations could be used to model how germinant binding induces conformational changes in gerBA and how these changes propagate to other receptor components . These simulations require either an experimentally determined structure or a high-confidence predicted structure as a starting point.

A multi-method approach combining these techniques would provide the most comprehensive understanding of the structural dynamics of gerBA during germination.

How should researchers analyze germination kinetics data to assess the impact of gerBA mutations?

Germination kinetics data requires careful analysis to extract meaningful information about gerBA function. Several analytical approaches are recommended:

Quantitative Comparison of Germination Rates: Germination rate constants can be derived from optical density measurements by fitting the data to appropriate kinetic models. For first-order kinetics, the rate of decrease in OD600 can be analyzed to determine the germination rate constant. These constants should be compared between wild-type and mutant strains under identical conditions to quantify the impact of gerBA mutations.

Dose-Response Analysis: By varying germinant concentrations, researchers can construct dose-response curves for wild-type and mutant gerBA strains. Analysis of these curves yields important parameters like EC50 (the germinant concentration producing half-maximal response) and the Hill coefficient (indicating cooperativity in the response). Shifts in these parameters between wild-type and mutant strains provide insights into how mutations affect germinant recognition or signal transduction.

Statistical Analysis of Germination Efficiency: As seen in studies of GerAB mutants, germination efficiency (percentage of spores that germinate) is a critical metric . Statistical analysis using appropriate tests (t-tests for pairwise comparisons or ANOVA for multiple comparisons) should be applied to determine if differences between strains are statistically significant. When reporting germination efficiency, both the mean values and measures of dispersion (standard deviation or standard error) should be included.

Multiple germination conditions should be tested, as gerBA mutations might have condition-specific effects. For example, some mutations might affect germination with only certain germinants or under specific environmental conditions (pH, temperature, etc.).

What are the best approaches for resolving conflicting data about gerBA function?

Conflicting results regarding gerBA function can arise from various sources, including differences in experimental conditions, strain backgrounds, or methodological approaches. Resolving these conflicts requires systematic analysis:

Standardization of Experimental Conditions: Establishing standardized protocols for spore preparation, germination assays, and data analysis is critical. Factors such as sporulation conditions, spore purification methods, and germination medium composition can significantly affect results. When comparing studies, these methodological details must be carefully considered.

Controlled Comparative Studies: When conflicting data emerges, direct comparative studies using multiple methods in parallel can be valuable. For example, if conflicting results exist regarding a specific gerBA mutation, researchers should test that mutation using several complementary approaches (germination assays, protein expression analysis, structural studies) within a single study.

Integration of Multiple Data Types: Triangulation across different data types can help resolve conflicts. For example, if functional assays suggest one model of gerBA action but structural data suggests another, additional experiments targeting the specific discrepancy should be designed. Western blot analysis of mutant strains, as used to confirm GerAA expression in Y97A mutants , can verify that observed phenotypes are due to the intended mutation rather than effects on protein expression or stability.

Meta-analysis Approaches: When sufficient data exists across multiple studies, formal meta-analysis techniques can quantitatively synthesize results to identify true effects versus study-specific anomalies. This approach is particularly valuable for resolving conflicting reports about the effects of specific mutations or conditions.

What are the current technical limitations in gerBA research and how might they be overcome?

Research on gerBA faces several technical challenges that limit progress in understanding its structure and function:

Protein Purification Challenges: As a likely membrane-associated protein, gerBA can be difficult to purify in a functional state. Advances in membrane protein purification, including the use of novel detergents, nanodiscs, or styrene-maleic acid copolymer lipid particles (SMALPs), offer promising approaches to obtain functionally active gerBA for biochemical and structural studies.

Structural Determination Limitations: Obtaining high-resolution structures of germinant receptors has been challenging. Recent advances in cryo-electron microscopy for membrane proteins and the development of computational structure prediction tools like AlphaFold represent promising approaches to overcome this limitation . These methods have been successfully applied to study related proteins like GerAB and could be extended to gerBA.

In vivo Monitoring Challenges: Directly observing receptor activation in intact spores is difficult. The development of novel biosensors that can report on gerBA conformational changes or local environmental changes during germination would provide valuable insights. For example, environment-sensitive fluorescent probes could be strategically incorporated into gerBA to report on activation events.

Heterogeneity in Spore Populations: Spore populations often exhibit heterogeneity in germination responses, complicating the interpretation of results. Single-spore analysis methods, including microfluidic approaches and time-lapse microscopy, can help address this challenge by tracking germination events at the individual spore level rather than in bulk populations.

How might research on gerBA inform broader understanding of signal transduction in bacterial spores?

Research on gerBA has implications that extend beyond B. subtilis germination to broader concepts in signal transduction and membrane protein function:

Comparative Analysis Across Species: Studying gerBA in B. subtilis provides a foundation for comparative studies across different spore-forming bacteria, including pathogenic species. Such comparisons can reveal conserved mechanisms of signal transduction during germination and identify species-specific adaptations. This knowledge could inform the development of strategies to control spore germination in medical and food safety contexts.

Integration with Systems Biology Approaches: Placing gerBA function within the broader context of germination regulation requires integration with systems-level analyses. Proteomics, transcriptomics, and metabolomics approaches can map the downstream effects of gerBA activation and identify additional components of the germination signaling network. Network analysis can then reveal how germinant recognition by gerBA connects to the multiple parallel pathways controlling spore awakening.

Model for Membrane Protein Channel Regulation: The germinant receptor system, including gerBA, represents an excellent model for studying how ligand binding regulates membrane protein channel activity. The insights gained from studying how germinant binding to gerBA leads to activation of channels formed by gerBB could inform understanding of other ligand-gated channels in various biological systems.

Applications in Synthetic Biology: Understanding the molecular details of gerBA function opens possibilities for engineering spores with novel germination specificities. The identified gain-of-function mutations in gerBA that allow response to D-alanine demonstrate that the germination response can be reprogrammed through targeted protein engineering. This approach could lead to the development of spores with tailored germination properties for applications in probiotics, bioremediation, or biosensing.

What emerging technologies might accelerate progress in understanding gerBA structure and function?

Several cutting-edge technologies show promise for advancing gerBA research:

Cryo-Electron Tomography: This technique can visualize the native arrangement of germinant receptors within the spore membrane, providing insights into their organization and potential interactions with other spore components. By capturing the receptor in different functional states, researchers might visualize conformational changes associated with activation.

Advanced Mass Spectrometry Techniques: Cross-linking mass spectrometry and native mass spectrometry can map protein-protein interactions within the germinant receptor complex and determine its stoichiometry. These approaches could clarify how gerBA interacts with gerBB and gerBC to form a functional receptor unit.

CRISPR-Based Genome Editing: CRISPR-Cas9 technology enables precise and efficient creation of gerBA mutants for structure-function studies. This approach allows for systematic mutagenesis to identify critical residues and regions within gerBA. Similar approaches have been valuable in identifying key residues in the related GerAB protein .

Artificial Intelligence for Structure Prediction: As demonstrated with GerAB, AI-based structure prediction tools like AlphaFold can provide valuable structural models when experimental structures are unavailable . These computational predictions can guide experimental design and help interpret functional data in a structural context. As these tools continue to improve, they will become increasingly valuable for studying complex membrane proteins like gerBA.

Microfluidic Single-Cell Analysis: Advanced microfluidic platforms allow researchers to track germination at the single-spore level under precisely controlled conditions. These approaches can reveal heterogeneity in germination responses and correlate it with variations in gerBA expression or activity. Time-resolved single-cell analysis can also capture the dynamics of the germination process with unprecedented resolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.