Recombinant Bacillus subtilis Spore maturation protein B (spmB)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview of Spore Maturation Protein B (spmB)

spmB (Spore maturation protein B) is a 178-amino-acid protein encoded by the spmB gene in Bacillus subtilis. It belongs to the SpmB family and is critical for spore core dehydration, a process essential for spore heat resistance and dormancy . While its exact mechanism remains partially understood, spmB is hypothesized to facilitate transport across the forespore membrane or modify cortex peptidoglycan structure during sporulation .

Key Molecular Features:

  • Operon Structure: spmB is cotranscribed with dacB (penicillin-binding protein 5*) and spmA in an operon .

  • Protein Interactions: Predicted functional partners include spmA (score: 0.999), dacB (0.950), and ylbJ (0.814), suggesting roles in cortex formation and spore morphogenesis .

  • Expression Timing: Expressed during sporulation stages II–III, overlapping with cortex synthesis and core dehydration .

Operon Organization

The dacB-spmA-spmB operon is transcribed from a single promoter upstream of dacB. Mutations in dacB disrupt transcription of spmA and spmB, while in-frame deletions in spmB do not affect upstream gene expression .

GeneFunctionRole in Sporulation
dacBPenicillin-binding protein 5*Modifies cortex peptidoglycan cross-linking
spmASpore maturation protein AFacilitates core dehydration
spmBSpore maturation protein BCore dehydration and cortex modification

Phenotypic Impacts of Mutations

Mutations in spmB lead to spores with reduced heat resistance and accelerated germination, despite normal cortex peptidoglycan structure . In contrast, dacB mutants exhibit altered cortex structure (e.g., increased peptide cross-linking) but normal core dehydration .

MutantCortex StructureCore DehydrationHeat ResistanceGermination
dacBAltered cross-linkingNormalReducedNormal
spmANormalDefectiveReducedFaster
spmBNormalDefectiveReducedFaster

Functional Partners and Pathways

spmB interacts with proteins involved in cortex formation (e.g., ylbJ, spoIVFB) and spore coat assembly (e.g., spoIVA, tlp) . These interactions suggest a role in coordinating dehydration with structural modifications.

Top Functional Partners

PartnerScoreRole
spmA0.999Core dehydration
dacB0.950Cortex peptidoglycan synthesis
ylbJ0.814Cortex formation
spoIVFB0.759Mother cell-forespore signaling

Mechanistic Insights

  • Core Dehydration: spmA and spmB mutants fail to achieve normal core water content, directly impacting heat resistance .

  • Cortex Modulation: While spmB does not alter cortex cross-linking (unlike dacB), it may influence membrane transport or peptidoglycan remodeling .

Recombinant Applications and Challenges

While spmB has not been explicitly engineered for recombinant protein production, B. subtilis spore systems leverage other coat proteins (e.g., CotB) for surface display . The GRAS status of B. subtilis and its robust genetic tools make it a promising platform for spore-based biotechnology, though spmB’s role remains specialized to sporulation .

Potential Research Directions:

  1. Structural Studies: Resolving spmB’s 3D structure to elucidate its transport or enzymatic activity.

  2. Synthetic Biology: Engineering spmB for enhanced dehydration or cross-membrane transport in bioengineered spores.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
spmB; ypuK; BSU23170; Spore maturation protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
spmB
Target Protein Sequence
MEIINWLSLAMIPIIIAGILLYGTIKKVPTYESFVEGGKEGIEIAFSIIPYLVGMLVAIT VFRSSGALDFIMDLLKPAFSAIGIPAEVVPLALIRPISGTAALGMTTDLIAVYGPDSFIG RLASVMQGSTDTTLYVLTVYFGAVGIKKMGDALKVGLLADLIGVVASIIIVTLLFGSA
Uniprot No.

Target Background

Function
Involved in spore core dehydration. It may participate in transporting substances into or out of the forespore or be necessary for modifying the cortex peptidoglycan structure.
Database Links

KEGG: bsu:BSU23170

Protein Families
SpmB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genetic context of Bacillus subtilis Spore maturation protein B (spmB)?

spmB is part of a three-gene operon that includes dacB (encoding penicillin-binding protein 5*) and spmA. These three genes are required for proper spore cortex synthesis and spore core dehydration . The genes were initially classified based on their role in spore maturation, hence the designation "spm" (spore maturation) . The operon structure is important for coordinated expression during the sporulation process, ensuring that all three proteins are available at the appropriate time for proper spore formation.

How does spmB contribute to spore properties in Bacillus subtilis?

Studies with spmB mutants have demonstrated that this protein is essential for achieving normal spore core dehydration . Mutant spores lacking functional spmB show reduced heat resistance compared to wild-type spores, indicating compromised protective capabilities . The defect in spore core dehydration is even more pronounced when both spmB and dacB expressions are lost, suggesting a synergistic relationship between these proteins . Interestingly, spmB mutant spores germinate faster than wild-type spores, likely due to altered spore structure affecting the germination process.

What phenotypic changes are observed in spmB mutant spores?

Spores produced by spmB mutants exhibit:

  • Reduced heat resistance

  • Failure to achieve normal spore core dehydration

  • Accelerated germination compared to wild-type spores

  • Normal cortex peptidoglycan structure (unlike dacB mutants)

  • Increased ratio of protoplast volume to sporoplast volume

These phenotypic changes indicate that spmB specifically affects water content in the spore core without altering the chemical composition of the cortex peptidoglycan.

What approaches can be used to study spmB function in spore formation?

To investigate spmB function, researchers can employ several experimental approaches:

  • Gene expression analysis: Using fusions to reporter genes like lacZ to monitor spmB expression during sporulation . This approach allows quantification of expression levels and timing during the sporulation process.

  • Mutagenesis studies: Creating specific mutations in the spmB gene to analyze the resulting phenotypes. This can identify critical functional domains within the protein .

  • Electron microscopy: Visualizing ultrastructural changes in spores lacking spmB. This technique can reveal alterations in cortex appearance and organization .

  • Measurement of spore properties: Quantifying heat resistance, core water content, and germination kinetics in wild-type versus mutant spores. These measurements provide functional data on how spmB affects spore characteristics .

  • Parametric experimental designs: Varying environmental conditions (temperature, nutrient availability) to determine how they affect spmB expression and function. This approach can help identify the regulatory mechanisms controlling spmB expression .

How can recombinant spmB be expressed for structural and functional studies?

For recombinant expression of spmB, researchers can consider:

  • Expression vectors: Utilizing either integrated or episomal plasmids for gene fusion and expression. Episomal vectors that replicate independently are often used for expressing target recombinant proteins .

  • Fusion strategies: Creating fusion proteins with well-characterized tags or partners to facilitate purification and analysis. For surface display applications, fusion with spore coat proteins like CotB has proven successful .

  • Expression systems: While E. coli is commonly used for protein expression, B. subtilis itself can be an appropriate host, especially for studying native interactions with other sporulation proteins.

  • Purification approaches: Implementing affinity chromatography with appropriate tags designed into the recombinant construct to isolate pure protein for biochemical analyses.

  • Activity assays: Developing specific assays to measure spmB function, possibly related to water movement or dehydration processes.

What single-subject experimental designs are suitable for studying spmB function?

For detailed mechanistic studies of spmB, single-subject experimental designs can be valuable:

  • A-B-A-B designs: These designs establish a baseline (A), introduce an intervention like recombinant spmB expression (B), return to baseline, and reintroduce the intervention. This approach allows for demonstration of causality when studying spmB effects on spore properties .

  • Multiple baseline designs: Useful when studying how spmB affects different aspects of sporulation or when examining spmB function across different Bacillus strains .

  • Parametric designs: These involve systematically varying a parameter (e.g., spmB concentration or expression timing) to determine dose-response relationships affecting spore properties .

  • Withdrawal designs: Can be implemented by using inducible promoters to control spmB expression at specific times during sporulation .

How can researchers utilize recombinant spmB in spore surface display technology?

Bacillus subtilis spore surface display (BSSD) technology represents a promising approach for expressing heterologous proteins with high activity and stability . While spmB itself is not typically used as a display anchor, understanding its role in spore formation is crucial for optimizing display systems:

  • Selection of appropriate anchor proteins: While CotB has been successfully used as a fusion partner for surface display , knowledge of how spmB affects spore structure can inform the selection and optimization of anchor proteins.

  • Optimization of expression timing: Since spmB functions during specific stages of sporulation, timing the expression of recombinant proteins to coincide with appropriate sporulation stages can improve display efficiency.

  • Evaluation of spore stability: Understanding how spmB contributes to spore resistance properties can help researchers design more robust display systems that maintain functionality under various conditions.

  • Enhancement of protein folding and activity: Insights from spmB's role in establishing spore core conditions might inform strategies to improve the folding and activity of displayed proteins.

How does spmB interact with other proteins in the sporulation pathway?

Understanding the protein interaction network involving spmB requires sophisticated approaches:

  • Co-immunoprecipitation studies: Using antibodies against spmB to pull down interacting proteins, followed by mass spectrometry identification.

  • Yeast two-hybrid or bacterial two-hybrid screens: Systematic screening for protein-protein interactions involving spmB.

  • Fluorescence resonance energy transfer (FRET): Tagging spmB and potential interaction partners with appropriate fluorophores to detect interactions in vivo during sporulation.

  • Crosslinking followed by mass spectrometry: Identifying proteins in close proximity to spmB during spore formation.

  • Genetic suppressor screens: Identifying mutations that suppress spmB mutant phenotypes, potentially revealing functional relationships.

How should researchers analyze spore resistance data when comparing wild-type and spmB mutant strains?

Analysis of spore resistance data requires careful consideration:

  • Statistical approaches:

    • For heat resistance experiments, survival curve analysis using log-linear models is appropriate

    • Multiple time points should be collected to construct accurate survival curves

    • Analysis of variance (ANOVA) can determine significant differences between strains

  • Controls and normalization:

    • Include multiple biological replicates (independent spore preparations)

    • Normalize data to initial spore counts

    • Include relevant control strains (e.g., wild-type, dacB mutant, spmA mutant)

  • Data presentation:

    StrainD-value at 80°C (min)D-value at 90°C (min)Relative heat resistance
    Wild-typeX1 ± SDY1 ± SD100%
    spmB mutantX2 ± SDY2 ± SDZ%
    dacB mutantX3 ± SDY3 ± SDZ%
    spmA mutantX4 ± SDY4 ± SDZ%

    Note: D-value represents the time required to reduce the viable spore population by 90% at a specific temperature.

What approaches are effective for visualizing and quantifying changes in spore structure resulting from spmB mutation?

Structural analysis of spores requires specialized techniques:

  • Electron microscopy quantification:

    • Measure cortex thickness in multiple spores (n>50)

    • Calculate the ratio of protoplast volume to sporoplast volume

    • Compare these measurements using appropriate statistical tests

  • Fluorescent probes for water content:

    • Use water-sensitive fluorescent dyes to visualize relative water content

    • Quantify fluorescence intensity across spore populations

    • Present data as frequency distributions rather than simple averages

  • Image analysis software:

    • Employ automated image analysis for objective quantification

    • Use machine learning approaches for feature detection and classification

    • Validate computational findings with manual measurements on subsets of images

How can researchers distinguish direct versus indirect effects of spmB mutation?

Distinguishing direct and indirect effects requires careful experimental design:

  • Temporal studies: Track the sequence of events following sporulation initiation to determine which changes occur first.

  • Complementation experiments: Express wild-type spmB in mutant strains under controlled conditions to determine which phenotypes are rescued immediately versus those requiring additional time.

  • Biochemical approaches: Isolate specific components (e.g., cortex material) from wild-type and mutant spores for direct comparison, independent of other spore properties.

  • Epistasis analysis: Construct double mutants with genes acting in related pathways to determine genetic relationships.

  • Computational modeling: Use systems biology approaches to model the sporulation network and predict direct versus indirect effects of spmB mutation.

What are the methodological challenges in isolating and characterizing spmB protein?

Researchers face several challenges when working with spmB:

  • Protein solubility: Membrane-associated proteins often present challenges for solubilization and purification while maintaining native structure.

  • Functional assays: Developing in vitro assays that accurately reflect spmB's in vivo function in spore dehydration.

  • Structural determination: Obtaining sufficient quantities of purified protein for structural studies using techniques like X-ray crystallography or cryo-electron microscopy.

  • Post-translational modifications: Identifying and characterizing any modifications that might be essential for spmB function.

  • Protein-protein interactions: Reconstituting physiologically relevant interactions in vitro to study the molecular mechanism.

What emerging technologies could advance understanding of spmB function?

Several cutting-edge approaches show promise for spmB research:

  • CRISPR-Cas9 genome editing: Enabling precise modifications to the spmB gene for structure-function studies.

  • Cryo-electron tomography: Visualizing the native state of spmB within intact spores at near-atomic resolution.

  • Single-cell tracking: Following individual cells through the sporulation process to correlate spmB expression with phenotypic outcomes .

  • Computational protein design: Applying data-driven approaches to engineer spmB variants with altered properties for fundamental research or biotechnological applications .

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to build comprehensive models of spmB function within the sporulation network.

How might knowledge of spmB function be applied in synthetic biology applications?

Understanding spmB function could enable novel applications:

  • Engineered spores with tailored properties: Creating spores with customized resistance profiles or germination characteristics by modifying spmB and related proteins.

  • Optimized display systems: Leveraging knowledge of spore structure for more efficient surface display of recombinant proteins .

  • Spore-based delivery systems: Developing spores that can deliver specific molecules to targeted environments, with release triggered by controlled germination.

  • Biosensors: Creating spores with sensing capabilities that respond to specific environmental signals through engineered germination pathways.

  • Bioremediation applications: Designing spores that can persist in contaminated environments and express enzymes for pollutant degradation upon germination .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.