Recombinant Bacillus subtilis Sporulation membrane protein ytrI (ytrI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ytrI; BSU29240; Sporulation membrane protein YtrI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ytrI
Target Protein Sequence
MRVPQHYKKPGWQRFFAGMMCGAVISWFFFLFTYGTFQEEQVSLIEKQKEHVKDLNNQIS IYQEDLHKLNEDNKRKLLIQSVSVKLLNGDKYKISQPDKTKFEEHVKDDISEVITKDIES VYQTKDLLKRTIENKVYMINEKKYEATVRELIIYTRLTVELEISFAT
Uniprot No.

Target Background

Function
Involved in Bacillus subtilis sporulation.
Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is ytrI protein and what is its function in B. subtilis?

The ytrI protein (UniProt No. O34460) is characterized as a sporulation membrane protein in Bacillus subtilis strain 168. It is a transmembrane protein consisting of 167 amino acids that plays a role in the complex developmental pathway of sporulation, which is triggered by nutrient limitation in B. subtilis . As a membrane protein, ytrI likely participates in membrane reorganization events that occur during the transition from vegetative growth to spore formation. The protein contains transmembrane domains that anchor it to the cell membrane during specific stages of the sporulation process. While its precise molecular function is still being elucidated, expression studies indicate it is regulated as part of the larger sporulation program controlled by sporulation-specific sigma factors.

For researchers investigating ytrI function, it is recommended to use both genetic approaches (gene knockouts, complementation studies) and protein localization techniques to determine its specific role during different stages of sporulation. Comparative studies with other Bacillus species can also reveal evolutionary conservation or divergence of ytrI function in spore-forming bacteria.

What expression systems are commonly used for recombinant ytrI protein?

For more native-like expression, B. subtilis-based expression systems can also be used. These provide the natural membrane environment and potentially correct post-translational modifications. Based on studies with other B. subtilis proteins, engineered B. subtilis strains like DB1342 with appropriate expression vectors can be effective for producing recombinant membrane proteins . These systems typically use inducible promoters such as the sacB promoter, which is activated by sucrose (typically at 2% concentration), allowing controlled expression of the target protein .

The optimal expression conditions for recombinant proteins in B. subtilis include:

ParameterOptimal Condition
Medium component: Dextrin16.6 g/L
Medium component: Tryptone19.2 g/L
Medium component: KH₂PO₄·H₂O6 g/L
Initial pH6.5
Inoculation ratio5% (v/v)
Induction timingAfter 1 hour of growth
Inducer (for sacB promoter)2% sucrose
Temperature30°C
Culture duration~56 hours

These conditions have been shown to significantly improve recombinant protein yield in B. subtilis and could serve as a starting point for optimizing ytrI expression .

What are the optimal storage conditions for recombinant ytrI protein?

According to product information, recombinant ytrI protein should be stored at -20°C for regular use, and at -20°C or -80°C for extended storage . When working with the protein, it's important to note that repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity. Working aliquots should be stored at 4°C and used within one week to maintain protein stability and function .

The shelf life of liquid protein preparations is typically around 6 months when stored at -20°C/-80°C, while lyophilized (freeze-dried) forms have a longer shelf life of approximately 12 months at -20°C/-80°C . These recommendations are particularly important for membrane proteins like ytrI, which tend to be more sensitive to denaturation during freeze-thaw cycles due to their hydrophobic domains and complex structure.

For long-term experimental planning, researchers should prepare multiple small aliquots during initial purification to avoid repeated freeze-thaw cycles of the entire protein stock. Additionally, the addition of glycerol (typically 10-20%) can help prevent freezing damage and maintain protein stability during storage.

How can response surface methodology (RSM) be applied to optimize ytrI expression?

Response Surface Methodology (RSM) is a statistical technique that can be used to optimize multiple variables simultaneously for maximizing recombinant protein expression, including challenging membrane proteins like ytrI. Based on approaches detailed in existing research, RSM can be applied to optimize ytrI expression through the following steps:

  • Identification of significant factors: Using two-level factorial experiments to determine which factors significantly affect ytrI expression. For membrane proteins, these might include media components, induction conditions, and growth parameters .

  • Determination of optimal conditions: Once significant factors are identified (e.g., dextrin and tryptone concentrations), central composite design (CCD) experiments can be performed to determine the precise optimal conditions for each factor .

  • Mathematical modeling: Developing a regression equation that describes the relationship between the significant factors and the response variable (ytrI expression level), which can be analyzed using statistical software like Design Expert .

The application of RSM can result in significant improvements in protein yield, as seen in case studies where optimized conditions increased protein yield by more than 30% compared to original conditions . For ytrI specifically, optimization would focus on:

Parameter CategoryVariables to Optimize
Media compositionCarbon source type and concentration
Nitrogen source type and concentration
Buffer components and initial pH
Culture conditionsInoculation ratio
Induction timing and inducer concentration
Temperature and culture duration
Host strain factorsProtease activity
Codon optimization

This systematic approach allows researchers to identify optimal conditions with fewer experiments than traditional one-factor-at-a-time methods, saving time and resources while achieving higher protein yields.

What are the challenges in purifying functional transmembrane proteins like ytrI?

Purifying functional transmembrane proteins like ytrI presents several unique challenges that require specialized approaches:

  • Solubilization: Membrane proteins are embedded in lipid bilayers and require detergents or other solubilizing agents to extract them from membranes. The choice of detergent is critical, as it must effectively solubilize the protein while maintaining its native structure and function.

  • Protein stability: Once removed from the membrane environment, transmembrane proteins often have reduced stability and can aggregate or denature. The addition of lipids or lipid-like molecules may be necessary to maintain protein stability during purification.

  • Purification efficiency: Traditional column chromatography methods may have reduced efficiency with detergent-solubilized proteins due to interference from the detergent micelles.

  • Protein yield: Membrane proteins like ytrI are often expressed at lower levels than soluble proteins, resulting in lower yields from purification processes.

A recommended purification strategy would include:

  • Initial extraction from membranes using mild detergents (e.g., DDM, LMNG)

  • IMAC purification utilizing the His-tag

  • Size exclusion chromatography to remove aggregates and detergent micelles

  • Functional verification using appropriate assays

Throughout the purification process, it's crucial to maintain conditions that preserve protein stability, including appropriate pH, ionic strength, and potentially the inclusion of specific lipids that interact with ytrI in its native environment.

How do mutations in the ytrI gene affect sporulation efficiency and membrane dynamics?

Investigation of the effects of ytrI mutations on sporulation efficiency and membrane dynamics would involve several experimental approaches:

  • Construction of ytrI knockout strains: Complete deletion of the ytrI gene to assess whether it is essential for sporulation or if its absence causes specific phenotypic changes in sporulation efficiency, timing, or spore morphology.

  • Site-directed mutagenesis: Creating specific mutations in functional domains of ytrI to identify critical residues for protein function. This might include:

    • Mutations in transmembrane domains to alter membrane insertion

    • Mutations in potential protein-protein interaction sites

    • Modifications to putative active sites or regulatory regions

  • Phenotypic characterization: Assessing the impact of these mutations on:

    • Sporulation efficiency (percentage of cells that successfully form spores)

    • Sporulation kinetics (time course of sporulation stages)

    • Spore resistance properties (heat, chemical, radiation resistance)

    • Spore germination efficiency

Studies comparing gene expression between Bacillus species have revealed temporal differences in the expression of genes governing sporulation, which suggests that mutations in ytrI might lead to altered timing of sporulation events rather than complete inhibition of the process . This makes time-course studies particularly important when analyzing ytrI mutant phenotypes.

For researchers investigating ytrI mutations, it is recommended to use a combination of genetic complementation, microscopy, and functional assays to comprehensively characterize the effects on sporulation. Fluorescent membrane dyes or tagged membrane proteins can be particularly useful for visualizing changes in membrane organization during sporulation in wild-type versus mutant strains.

What are effective strategies for labeling and tracking ytrI protein in live cells?

To study the dynamics and localization of ytrI protein in live B. subtilis cells during sporulation, several labeling and tracking strategies can be employed:

  • Fluorescent protein fusions: Creating C-terminal or N-terminal fusions of ytrI with fluorescent proteins like GFP, mCherry, or mScarlet. For membrane proteins like ytrI, care must be taken to ensure that the fusion doesn't disrupt membrane insertion or protein function. Complementation studies with the fusion protein in a ytrI knockout strain can confirm functionality.

  • Split-GFP system: This approach uses a split version of GFP where one fragment is fused to ytrI and the other is expressed separately. This system minimizes the size of the tag on ytrI and only produces fluorescence when the protein is correctly localized.

  • SNAP or CLIP tag fusions: These self-labeling protein tags can be fused to ytrI and allow specific labeling with cell-permeable fluorescent substrates at different time points during sporulation.

  • Super-resolution microscopy: Techniques like STORM, PALM, or STED can be used with these labeling approaches to overcome the diffraction limit and observe fine details of ytrI localization in the membrane.

The choice of labeling strategy should consider:

ConsiderationRecommendation
Tag positionC-terminal tagging may be preferable if N-terminus is involved in membrane insertion
Tag sizeSmaller tags (e.g., split-GFP, SNAP-tag) may cause less functional disruption
Expression levelNative promoter expression to maintain physiological levels
Imaging methodTime-lapse microscopy to track dynamic changes during sporulation
ControlsComplementation assays to verify tagged protein functionality

When designing these experiments, it's important to confirm that the labeled protein retains its normal function and localization, typically by complementation studies in a ytrI knockout background. This ensures that observed localization patterns reflect the true behavior of the native protein.

How does ytrI expression compare between different Bacillus species during sporulation?

Based on comparative studies of Bacillus species, there are interesting differences in gene expression patterns related to sporulation between species like B. subtilis, B. anthracis, and Listeria monocytogenes . To specifically compare ytrI expression across different Bacillus species, the following approaches would be valuable:

  • Comparative genomics: Identifying ytrI homologs in different Bacillus species through sequence alignment and synteny analysis to reveal if ytrI is conserved across species and if there are variations in the gene sequence that might indicate functional differences.

  • Transcriptomics: Performing RNA-seq analysis of different Bacillus species during sporulation to compare the timing and level of ytrI expression. There may be temporal differences in the expression of sporulation genes between species, which could be investigated specifically for ytrI .

  • Quantitative RT-PCR: For more targeted analysis, qRT-PCR can be used to measure ytrI transcript levels at specific time points during sporulation across different species.

  • Cross-species complementation: Testing whether the ytrI gene from one Bacillus species can complement a ytrI knockout in another species, which would indicate functional conservation.

One interesting finding from comparative studies is that there appears to be a temporal difference in the expression of genes governing sporulation in different Bacillus species . This suggests that ytrI expression timing might vary between species, potentially contributing to species-specific characteristics of spores.

Researchers interested in evolutionary aspects of sporulation should consider using multi-species biclustering methods as described in existing research, which can identify gene groups with conserved modularity across species . This approach could reveal whether ytrI is part of a conserved gene module or if its regulatory pattern has diverged between species.

How can CRISPR-Cas9 be used to study ytrI function in B. subtilis?

CRISPR-Cas9 technology offers powerful approaches for studying ytrI function in B. subtilis through precise genetic manipulations:

  • Gene knockout studies:

    • Creating complete ytrI deletion strains to assess loss-of-function phenotypes

    • Generating knockouts with minimal polar effects on neighboring genes

    • Creating marker-free deletions to avoid interference from antibiotic resistance genes

  • Precise point mutations:

    • Introducing specific amino acid substitutions to test the importance of particular residues

    • Creating mutations in potential functional domains without disrupting the entire protein

    • Engineering conservative vs. non-conservative substitutions to assess structural vs. functional roles

  • Protein tagging:

    • Adding epitope tags or fluorescent protein fusions at precise locations

    • Creating C-terminal vs. N-terminal fusions to determine optimal tagging strategies

    • Introducing split tags for protein complementation assays

  • CRISPRi (CRISPR interference) applications:

    • Using catalytically dead Cas9 (dCas9) to repress ytrI expression without modifying the gene

    • Creating tunable repression by controlling dCas9 expression levels

    • Targeting different regions of the ytrI gene or promoter to assess their importance

The advantage of CRISPR-Cas9 over traditional genetic engineering approaches is the precision and efficiency with which genetic modifications can be made. For ytrI specifically, this allows researchers to create subtle mutations that might affect specific aspects of protein function (such as membrane localization or protein-protein interactions) without completely abolishing expression.

A methodological workflow for CRISPR-based modification of ytrI would include:

  • Design of guide RNAs targeting specific regions of ytrI

  • Construction of repair templates containing desired modifications

  • Transformation of B. subtilis with Cas9, guide RNA, and repair template

  • Screening for successful modifications

  • Phenotypic characterization focusing on sporulation processes

These CRISPR-based approaches provide unprecedented precision in genetic manipulation, allowing researchers to dissect ytrI function with minimal disruption to other cellular processes.

What methods can be used to determine the topology of ytrI in the membrane?

Understanding the precise topology of ytrI in the membrane (i.e., which portions are inside the cell, which span the membrane, and which are exposed to the outside) is crucial for functional studies. Several complementary methods can be used:

  • Computational prediction:

    • Hydrophobicity analysis to identify potential transmembrane domains

    • Topology prediction algorithms (e.g., TMHMM, Phobius, TOPCONS)

    • Signal peptide prediction tools

    • Comparative analysis with structurally characterized homologs

  • Biochemical methods:

    • Protease protection assays: Limited proteolysis of inside-out vs. right-side-out membrane vesicles

    • Chemical modification: Using membrane-impermeable reagents to label exposed residues

    • SCAM (substituted-cysteine accessibility method): Replacing residues with cysteine and testing their accessibility to membrane-permeable vs. impermeable sulfhydryl reagents

  • Genetic fusion approaches:

    • PhoA (alkaline phosphatase) fusions: Active when located outside the cytoplasm

    • GFP fusions: Fluorescent when located in the cytoplasm

    • Split protein complementation with fragments located in different cellular compartments

The results from these various approaches should be integrated to develop a comprehensive model of ytrI's membrane topology. For example, a table mapping specific residues to their predicted location might look like:

Residue RangePredicted LocationMethod of Determination
1-20CytoplasmicComputational prediction, GFP fusion
21-43TransmembraneHydrophobicity analysis, SCAM
44-60ExtracellularPhoA fusion, protease sensitivity
61-85TransmembraneComputational prediction, SCAM
86-167CytoplasmicGFP fusion, protease protection

This comprehensive topological mapping would provide valuable insights into ytrI's functional mechanisms during sporulation and guide further experimental design for structure-function studies.

How does the lipid composition of the membrane affect ytrI function and localization?

The lipid environment can significantly influence membrane protein function and localization. For ytrI, the following approaches can be used to investigate lipid-protein interactions:

  • Lipidomic analysis:

    • Comparative lipidomics of B. subtilis membranes during different growth phases and sporulation stages

    • Analysis of lipid composition in membrane microdomains where ytrI localizes

    • Changes in lipid composition in ytrI knockout vs. wild-type strains

  • In vitro reconstitution studies:

    • Reconstituting purified ytrI into liposomes of defined lipid composition

    • Measuring protein activity or structural properties in different lipid environments

    • Testing the effects of specific lipids (e.g., cardiolipin, phosphatidylethanolamine) on protein function

  • Fluorescence microscopy approaches:

    • Co-localization of fluorescently labeled ytrI with specific lipid dyes or lipid-binding probes

    • FRET between labeled ytrI and fluorescent lipid analogs

    • Single-molecule tracking of ytrI in membranes with different lipid compositions

These studies would be particularly relevant for understanding ytrI function during sporulation, as the process involves dramatic membrane remodeling events and changes in membrane composition. Specific lipids may be required for proper ytrI function or might regulate its activity during different stages of sporulation.

The results from such studies could be presented in a format tracking the correlation between specific lipid compositions and ytrI activity:

Lipid CompositionEffect on ytrI LocalizationEffect on ytrI Function
High cardiolipinLocalization to cell polesEnhanced activity
High phosphatidylethanolamineUniform distributionModerate activity
High phosphatidylglycerolExclusion from specific domainsReduced activity

Understanding these lipid-protein interactions would provide insights not only into ytrI function but also into the broader mechanisms of membrane protein regulation during bacterial developmental processes.

What is the role of ytrI in stress response besides sporulation?

While sporulation is the primary response of B. subtilis to certain stresses (particularly nutrient limitation), many sporulation-associated proteins also play roles in other stress responses. To investigate potential additional roles of ytrI in stress responses:

  • Transcriptional analysis under different stress conditions:

    • Heat shock (elevated temperatures)

    • Cold shock (low temperatures)

    • Osmotic stress (high salt or sugar concentrations)

    • Oxidative stress (hydrogen peroxide, paraquat)

    • pH stress (acidic or alkaline conditions)

    • Antibiotic exposure (cell wall, membrane, or protein synthesis inhibitors)

  • Phenotypic characterization of ytrI knockout strains under stress conditions:

    • Growth curve analysis under various stresses

    • Survival rate measurements after acute stress exposure

    • Microscopic examination for morphological changes

    • Membrane integrity assays using fluorescent dyes

  • Regulatory network analysis:

    • Determining if ytrI is regulated by stress-responsive sigma factors other than those specific to sporulation

    • Identifying potential binding sites for stress-responsive transcription factors in the ytrI promoter region

Understanding the broader role of ytrI in stress responses could reveal its function beyond sporulation and provide insights into how B. subtilis integrates different stress response pathways. This knowledge would be valuable for developing comprehensive models of bacterial adaptation to environmental challenges and could potentially inform strategies for controlling bacterial survival in various applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.