Recombinant Bacillus subtilis Sporulation protein yjcA (yjcA)

Shipped with Ice Packs
In Stock

Description

Background and Function

Research Findings

  • Expression and Regulation: Sporulation genes, including those like yjcA, are tightly regulated and expressed at specific stages of sporulation. The expression of these genes is often dependent on specific sigma factors, which are RNA polymerase subunits that direct transcription to different promoters .

  • Mutational Studies: Mutational studies on related proteins have shown that disruptions in sporulation genes can lead to defects in spore formation and resistance. For example, mutations in yjcC result in spores with reduced resistance to lysozyme and heat .

Recombinant Production

  • Recombinant Expression: Recombinant yjcA is produced through genetic engineering techniques where the gene encoding yjcA is inserted into a suitable expression vector and expressed in a host organism, often B. subtilis itself or other bacteria like E. coli.

  • Applications: Recombinant proteins like yjcA can be used for research purposes, such as studying the sporulation process or developing new biotechnological applications related to spore formation and resistance.

Comparison with Other Sporulation Proteins

ProteinFunctionExpression Stage
yjcAUnknown, involved in sporulationSpecific stage of sporulation
yjcC (spoVIF)Involved in spore coat assemblyStage VI of sporulation
SpoIIIJRequired for spore formation, involved in membrane protein biogenesisSpecific stage of sporulation

References

  1. ChemicalBook - Recombinant Bacillus subtilis proteins.

  2. Kuwana et al. (2002) - Bacillus subtilis spoVIF (yjcC) gene involved in coat assembly and resistance.

  3. Structure-Function Studies of the Bacillus subtilis Ric Proteins (2019) - Although not directly related to yjcA, this study highlights the complexity of protein functions in B. subtilis.

  4. SpoIIIJ and YqjG Function in Membrane Protein Biogenesis (2009) - Demonstrates the role of other proteins in B. subtilis related to membrane biogenesis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yjcA; BSU11790; Sporulation protein YjcA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yjcA
Target Protein Sequence
MVINGLTIVLLSLAVFRLARLLVFDTIMAPLRSLFHEEKEEKDADGNIETYIVIKGTGVR AFIGELLSCYWCTGVWCAGFLILCQAVIPQAAQWLILLLAIAGLAGIIETLVSKWLQE
Uniprot No.

Target Background

Function

Involved in sporulation.

Database Links
Protein Families
UPF0713 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.