Recombinant Bacillus subtilis Sporulation protein yunB (yunB)

Shipped with Ice Packs
In Stock

Description

General Overview of Recombinant Bacillus subtilis Sporulation Protein YunB

Bacillus subtilis is a Gram-positive bacterium known for its ability to form spores, a process called sporulation, under nutrient-depleted conditions . This process is controlled by a series of regulatory and structural genes . Recombinant Bacillus subtilis sporulation protein YunB refers to the YunB protein produced using genetic engineering techniques . Specifically, the recombinant approach involves modifying the bacterial genome to express a protein of interest as a fusion with a spore coat protein .

Role of Sporulation Genes

Sporulation in Bacillus subtilis is initiated by the activation of histidine sensor kinases, such as KinA, KinB, and KinC, which then shuttle phosphate through a phosphorelay system, leading to the phosphorylation of the transcription factor Spo0A, the master regulator of sporulation . KinA is the primary kinase responsible for initiating sporulation, and its overexpression can induce sporulation regardless of nutrient availability .

YunB and its Impact on Sporulation Efficiency

Research has shown that mutations in certain sporulation genes, including yunB, can affect sporulation efficiency . A study of several σE-controlled genes found that while single mutations in genes like yunB caused only a mild defect in sporulation, pairwise combinations of these mutations could lead to strong synthetic sporulation phenotypes .

Table: Synergistic Effects of Mutations on Sporulation Efficiency

GenotypePredicted sporulation efficiencyActual sporulation efficiencySynergistic effect
WT1.0
yunB0.5
ytrI0.14
ybaN0.12
ytrH0.11
yunB ybaN0.060.023
yunB ytrH0.060.023
yunB ytvI0.150.131.2
ypjB yunB0.130.121
yhbH yunB0.130.190.7

As shown in the table, the synergistic effect is calculated by dividing the actual sporulation efficiency by the predicted sporulation efficiency. The predicted sporulation efficiency for double mutants is the product of the sporulation efficiencies of the single mutants.

Spore Surface Display Technology

Bacillus subtilis is used in spore surface display technology, which has two main approaches: recombinant and nonrecombinant . The recombinant approach involves modifying the bacterium's genome to express a protein of interest as a fusion with a spore coat protein . This method simplifies the production process by avoiding the need to isolate and purify foreign proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yunB; BSU32350; Sporulation protein YunB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yunB
Target Protein Sequence
MPRYRGPFRKRGPLPFRYVMLLSVVFFILSTTVSLWMINGSIKPVLMDIGEMETKRIATE VIQDSIEDYMSDSENMKDMFQMNSDENGNLTTIDFNTQVVNSVKTKVTKQLQAHLKEMET HTGHSGASENIMINIPLGQVTGNSLLGNLGPKIPVRFNLIGDAFTDVKTKIKPYGINNAL IDISIFVEIKVKVIIPFASKTAVVTNNVPVSIKAVQGEVPQFYNGSGGSGVTPSVQLPSS KENGADSKKEKSSK
Uniprot No.

Target Background

Function
Essential for sporulation.
Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the function of YunB protein in B. subtilis sporulation?

YunB is a protein involved in the sporulation process of Bacillus subtilis. While its exact function isn't fully characterized, it plays a role in the complex morphological differentiation that occurs during spore formation. Sporulation in B. subtilis is initiated in response to nutrient limitation and involves the formation of an asymmetric septum near one pole of the cell, creating a smaller forespore compartment and a larger mother cell compartment .

Methodological approach to study YunB function:

  • Create deletion mutants using markerless gene deletion systems based on the mannose phosphoenolpyruvate-dependent phosphotransferase system as described in previous B. subtilis genome reduction efforts

  • Compare phenotypes of wild-type and ΔyunB strains under sporulation-inducing conditions

  • Use fluorescent protein fusions to track YunB localization during different stages of sporulation

  • Perform protein-protein interaction studies to identify YunB's interaction partners during sporulation

How can I express and purify recombinant YunB protein for functional studies?

Expression and purification of recombinant YunB requires careful optimization due to potential challenges related to protein folding and solubility.

Methodological approach:

  • Expression system selection:

    • For cytoplasmic expression: Use genome-reduced B. subtilis strains like IIG-Bs-27-39 which lack ~21.6% of the parental genome and show improved expression of difficult proteins

    • For secretory expression: Utilize signal peptides with the general secretion pathway (Sec) or the Twin-arginine (Tat) translocation system

  • Vector design:

    • For inducible expression: Use IPTG-inducible promoters (Pspac) or alternative sugar-inducible systems like the Pgrac promoter

    • For constitutive expression: Consider the P23 promoter derived from PsrfA

  • Purification strategy:

    • Add appropriate affinity tags (His-tag is commonly used) for simplified purification

    • For YunB specifically, consider using mammalian cell expression systems for production as indicated in commercial recombinant YunB products

    • Perform initial centrifugation at low speed to separate cell debris

    • Use metal affinity chromatography followed by size exclusion chromatography

  • Storage conditions:

    • Add 5-50% glycerol (final concentration) and store in aliquots at -20°C/-80°C to prevent repeated freeze-thaw cycles

    • For short-term storage, keep working aliquots at 4°C for up to one week

How does YunB localization change during the sporulation process?

Understanding the spatial and temporal dynamics of YunB during sporulation provides insights into its function. The proper targeting of sporulation proteins is critical for successful spore development.

Methodological approach:

  • Fluorescent protein fusion studies:

    • Create C-terminal and N-terminal fusions of YunB with fluorescent proteins (GFP, mCherry)

    • Ensure the fusion doesn't disrupt protein function through complementation tests

    • Use time-lapse fluorescence microscopy to track YunB localization during sporulation stages

  • Immunofluorescence microscopy:

    • Develop antibodies specific to YunB

    • Perform immunostaining at different time points during sporulation

    • Co-stain with markers for different compartments (forespore, mother cell)

  • Protein fractionation analysis:

    • Isolate different cellular fractions (membrane, cytoplasmic, spore coat) at various sporulation stages

    • Detect YunB using Western blotting in each fraction

    • Compare localization patterns in wild-type versus mutant strains affecting sporulation

Based on similar studies of sporulation proteins, YunB likely undergoes specific targeting to either the forespore or mother cell compartment after asymmetric division .

What is the impact of protein aggregates on YunB function during sporulation?

Recent research has examined how protein aggregates (PAs) affect sporulation in B. subtilis, which may influence YunB activity and function.

Methodological approach:

  • Inducible PA formation system:

    • Develop an inducible synthetic PA model system similar to that described by researchers studying PA dynamics in B. subtilis

    • Induce PA formation at different stages of sporulation

    • Assess impacts on YunB localization and function

  • Stress response analysis:

    • Subject sporulating cells to conditions promoting protein misfolding

    • Monitor changes in YunB expression, localization, and functionality

    • Assess spore quality and resistance properties

Research findings indicate that the sporulation process in B. subtilis is remarkably robust against perturbations by protein aggregates and misfolded proteins . PAs can persist throughout the entire sporulation process after encapsulation in the forespore, without showing deleterious effects on sporulation, germination, or spore survival against heat or UV stress .

How can I use YunB as a carrier protein for spore surface display?

The spore surface display technology in B. subtilis allows for the expression of heterologous proteins on the spore surface, which has applications in vaccine development, enzyme display, and other biotechnological applications.

Methodological approach:

  • Fusion protein design:

    • Create translational fusions of YunB with your protein of interest

    • Consider both N-terminal and C-terminal fusions to determine optimal orientation

    • Include flexible linkers between YunB and the target protein to minimize structural interference

  • Expression and display optimization:

    • Follow the recombinant approach to spore surface display, which requires modification of the bacterial genome to express the protein of interest as a fusion with spore coat protein

    • Consider the regulation of spore coat protein expression during sporulation

    • Evaluate different promoters for optimal expression timing during sporulation

  • Verification of surface display:

    • Use fluorescence microscopy if the target protein is fluorescent

    • Perform immunofluorescence using antibodies against the target protein

    • Assess functionality of the displayed protein through activity assays

Researchers have successfully used other spore coat proteins like OxdD (inner-coat) and CotG (outer-coat) for this purpose, showing that despite the higher abundance of CotG, OxdD fusion proteins showed better surface representation .

How do genome-reduced B. subtilis strains affect recombinant YunB expression and functionality?

Genome-reduced B. subtilis strains have been developed to improve heterologous protein production by removing dispensable or counterproductive genomic regions.

Methodological approach:

  • Strain selection and characterization:

    • Compare YunB expression in standard strains (e.g., 168) versus genome-reduced strains like IIG-Bs-27-39

    • Analyze growth characteristics and metabolic parameters during bioreactor cultivation

    • Assess YunB yield, solubility, and functionality across different strains

  • Metabolic profiling:

    • Measure key metabolic parameters including ATP yield, ATP/ADP levels, and adenylate energy charge

    • Analyze intracellular NADPH levels which are significantly increased in genome-reduced strains

    • Evaluate changes in byproduct formation and internal amino acid pools

Recent research on the genome-reduced B. subtilis strain IIG-Bs-27-39 has shown superior secretion of difficult-to-produce proteins, higher specific growth rates, and increased biomass yields compared to the parental strain . This strain lacks ~21.6% of the genome, with deletions targeting mobile genetic elements, extracellular proteases, sporulation, flagella formation, and antibiotic production genes .

ParameterStrain 168IIG-Bs-27-39 strain
Genomic content100%~78.4%
Protein secretion capacityBase levelEnhanced for difficult proteins
Specific growth rateBase levelHigher
Biomass yieldBase levelHigher
Total cellular NADPH levelBase levelSignificantly increased
NAD+ and NADPH pools during protein productionBase levelIncreased

What regulatory networks control yunB gene expression during sporulation?

The sporulation process in B. subtilis is tightly controlled by a complex regulatory network involving multiple transcription factors and signaling pathways.

Methodological approach:

  • Transcriptional regulation analysis:

    • Perform promoter mapping using 5' RACE or similar techniques

    • Create promoter-reporter fusions with various truncations to identify regulatory elements

    • Use ChIP-seq to identify transcription factors binding to the yunB promoter region

  • Regulatory network mapping:

    • Analyze yunB expression in mutants affecting key sporulation regulators (Spo0A, σF, σE, σG, σK)

    • Perform RNA-seq to identify genome-wide expression changes in yunB mutants

    • Use systems biology approaches to integrate transcriptomic and proteomic data

  • Signal transduction analysis:

    • Investigate the role of kinases (KinA, KinB, KinC) in controlling yunB expression

    • Analyze the phosphorelay system leading to Spo0A phosphorylation

    • Assess the impact of nutrient availability on yunB regulation

Research has shown that sporulation in B. subtilis is triggered by the activation of histidine sensor kinases (KinA, KinB, KinC) which shuttle phosphate through an extended phosphorelay, resulting in phosphorylation of the master regulator Spo0A . KinA is the major kinase responsible for initiating sporulation, and KinA (or KinB) overexpression during exponential growth is sufficient to induce entry into sporulation .

What are the latest methodologies for studying protein-protein interactions involving YunB?

Understanding the protein interaction network of YunB is crucial for elucidating its function during sporulation.

Methodological approach:

  • In vivo interaction studies:

    • Bimolecular Fluorescence Complementation (BiFC)

    • Förster Resonance Energy Transfer (FRET)

    • Protein-fragment Complementation Assays (PCA)

    • Proximity labeling techniques (BioID, APEX)

  • In vitro interaction studies:

    • Pull-down assays using purified recombinant YunB

    • Surface Plasmon Resonance (SPR)

    • Isothermal Titration Calorimetry (ITC)

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)

  • Computational predictions:

    • Protein docking simulations

    • Coevolution analysis to predict interacting residues

    • Integration of structural information with interaction data

  • Structural studies:

    • X-ray crystallography of YunB complexes

    • Cryo-electron microscopy for larger assemblies

    • NMR for studying dynamic interactions

When designing interaction studies, it's important to consider the specific cellular context of sporulation, including the compartmentalization that occurs during this process.

How can microRNA technology enhance recombinant YunB production in eukaryotic expression systems?

While B. subtilis is commonly used for YunB expression, eukaryotic systems like CHO cells can offer advantages for certain applications, particularly when post-translational modifications are required.

Methodological approach:

  • miRNA selection and optimization:

    • Screen plasma cell-specific miRNAs for improving recombinant protein expression

    • Test miRNAs known to enhance productivity in CHO cells, such as miR-17, miR-19b, miR-20a, miR-92a, miR-2861, and miR-557

    • Create stable cell lines overexpressing the selected miRNAs

  • Expression system engineering:

    • Optimize the signal peptide for efficient secretion

    • Consider codon optimization for CHO cell expression

    • Evaluate the impact of miRNA overexpression on protein quality attributes

  • Process development:

    • Optimize culture conditions for miRNA-enhanced cell lines

    • Monitor impact on cell growth, viability, and specific productivity

    • Assess product quality attributes including aggregation and glycosylation

Research has shown that certain miRNAs can enhance recombinant protein expression in CHO cells by promoting proliferation, resisting apoptosis, and improving cellular functions . For example, miR-183-5p, miR-17-3p, miR-138-5p, miR-342-5p, and miR-491-5p resulted in significant increases in unit yield by 13-50% in CHO-K1-mAb2 cells .

miRNAEffect on CHO cell productivityAdditional benefits
miR-182-5p, miR-421-4p, miR-130b-3p, miR-183-5p, miR-1839-5p, miR-374b-5p, miR-1839-3pIncreased specific productivity by 15-23%-
miR-130b-3p, miR-374B-5p, miR-1839-3pIncreased antibody titer by 14-19%-
miR-183-5p, miR-17-3p, miR-138-5p, miR-342-5p, miR-491-5pIncreased unit yield by 13-50%-
miR-711, miR-484, miR-425-5pIncreased antibody yield by 16-26%Growth-promoting properties
miR-557Enhanced productivityNo negative effect on N-linked glycosylation, mAb aggregation/fragmentation

Why is my recombinant YunB protein showing low expression levels in B. subtilis?

Low expression of recombinant YunB could be due to several factors related to the expression system, protein properties, or experimental conditions.

Methodological approach to troubleshooting:

  • Expression system optimization:

    • Test different promoters: IPTG-inducible (Pspac), sugar-inducible (xylose, mannose), or constitutive promoters

    • Evaluate self-inducing expression systems which have shown increased efficiency

    • Consider genome-reduced strains like IIG-Bs-27-39 which show improved expression for difficult proteins

  • Genetic construct design:

    • Check for rare codons and consider codon optimization

    • Evaluate different signal peptides if secretory expression is desired

    • Test both N-terminal and C-terminal fusion tags

  • Culture conditions optimization:

    • Adjust temperature, as lower temperatures often improve soluble protein yield

    • Optimize media composition, particularly amino acid content

    • Fine-tune inducer concentration and timing of induction

  • Protein stability enhancement:

    • Use strains with reduced protease activity (e.g., WB800 strain lacking eight protease genes)

    • Add protease inhibitors during extraction

    • Optimize buffer conditions for protein stability

A comparative analysis of different expression systems is recommended to identify the optimal approach for YunB expression.

How can I improve the stability and functionality of recombinant YunB protein?

Maintaining stability and functionality of recombinant YunB is crucial for downstream applications and analysis.

Methodological approach:

  • Buffer optimization:

    • Screen different buffer compositions using thermal shift assays

    • Test various pH conditions to identify optimal stability range

    • Evaluate the effect of different salts and additives

  • Storage condition optimization:

    • Add 5-50% glycerol (final concentration) for long-term storage

    • Aliquot to prevent repeated freeze-thaw cycles

    • For short-term use, store at 4°C for up to one week

  • Structural analysis and engineering:

    • Identify unstable regions through limited proteolysis or HDX-MS

    • Consider introducing stabilizing mutations based on structural analysis

    • Evaluate the impact of fusion partners on stability

  • Functional assay development:

    • Develop robust assays to assess YunB functionality

    • Use these assays to monitor stability under different conditions

    • Correlate structural changes with functional outcomes

According to product information, the shelf life of lyophilized recombinant YunB is 12 months at -20°C/-80°C, while the liquid form is stable for 6 months at the same temperatures .

What are the emerging applications of YunB in synthetic biology?

As our understanding of YunB function expands, new applications in synthetic biology are emerging.

Promising research directions:

  • Engineered spore-based delivery systems:

    • Design YunB-fusion proteins for spore surface display of therapeutic molecules

    • Develop spore-based vaccines using YunB as a carrier protein

    • Create biosensors with spore-displayed recognition elements

  • Synthetic sporulation circuits:

    • Engineer synthetic regulatory networks incorporating YunB

    • Design orthogonal sporulation systems with modified YunB functionality

    • Create tunable sporulation switches for biotechnological applications

  • Novel biomaterials:

    • Develop self-assembling protein structures incorporating YunB domains

    • Create spore-based functional materials with tailored properties

    • Design environmentally responsive materials using sporulation proteins

  • Cell-free expression systems:

    • Incorporate YunB and related proteins into cell-free expression platforms

    • Develop high-throughput screening systems for protein engineering

    • Create minimal sporulation systems in vitro

The robust nature of the sporulation process against perturbations by protein aggregates suggests that YunB and other sporulation proteins may have unique properties suitable for various synthetic biology applications.

How does the fundamental knowledge of YunB contribute to understanding bacterial differentiation?

Understanding YunB contributes to our broader knowledge of bacterial differentiation and development.

Key research questions:

  • Evolutionary perspectives:

    • Comparative analysis of YunB homologs across different bacterial species

    • Reconstruction of the evolutionary history of sporulation systems

    • Identification of conserved and species-specific features of sporulation proteins

  • Systems-level understanding:

    • Integration of YunB into comprehensive models of sporulation

    • Elucidation of the minimal gene set required for sporulation

    • Understanding redundancy and robustness in sporulation networks

  • Developmental biology insights:

    • Mechanisms of asymmetric cell division involving YunB

    • Protein targeting and localization principles applicable to other systems

    • Temporal coordination of complex developmental processes

  • Stress response connections:

    • Links between sporulation and other stress responses

    • Role of YunB in integrating environmental signals

    • Cross-talk between different cellular differentiation pathways

As more data emerges on YunB function, it will contribute to our understanding of fundamental biological processes beyond sporulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.