Recombinant Bacillus subtilis Stage II sporulation protein B (spoIIB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a particular tag type is required, please specify it for preferential development.
Synonyms
spoIIB; BSU28060; Stage II sporulation protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
spoIIB
Target Protein Sequence
MKKRKNKKNSKAAEKALKVTINGKEETVYEQETPETEANKSMTFSNWEEKRQAEQEVAAS QEHPDEDEFNWDSEEDKVFKEDPKVVPPFQKKKTKLYAKGKTGAAKPVKRVAATIAFAAV IGTGLGLFALNISGNKEASAPASLEDSLGSQTAKAGDTSADKQTSGAEKQAAQTEGTYKT YAVQAGKFSNEKGAETLTEQLTEKGYSAVSLSKDDGYTYVIAGLASEKEVSQQLGQVLID SDFEAWGGKELSLSIESDMTDSFKETAELAAKAILDEDITKASVEKIEKSLGETKASETG EKKAILQALKELEDPSAEAGWKAQQELLAVVK
Uniprot No.

Target Background

Function
Plays a role in endospore development.
Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the basic structure and characteristics of SpoIIB protein?

SpoIIB is a 332-codon-long open reading frame that encodes a 36-kDa polypeptide. The protein is highly charged and contains a stretch of uncharged amino acids that likely forms a transmembrane segment. The gene is under sporulation control, being specifically activated during the sporulation pathway .

The protein's structure appears optimized for its localization at the sporulation septum, where it participates in septal peptidoglycan processing. Unlike many other sporulation proteins, SpoIIB's functional domains are still being characterized, though its structural features suggest membrane association is important for its function .

What is the genomic context of the spoIIB gene in Bacillus subtilis?

The spoIIB gene is located in a gene cluster with a specific orientation and organization. The order of genes in the vicinity of spoIIB is: valS-folC-comC-spoIIB-orfA-orfB-mreB-mreC-mreD-minC-minD-spoIVFA-spoIVFB-L20-orfX-L24-spoOB-obg-pheB-pheA. All 20 genes share the same orientation, with transcription direction running from valS to pheA . This genomic organization may have implications for coordinated expression during the sporulation process.

How does SpoIIB contribute to the sporulation process in Bacillus subtilis?

SpoIIB plays a specialized role in facilitating the rapid and spatially regulated dissolution of septal peptidoglycan during sporulation. This activity is essential for efficient engulfment, which is a critical step in spore formation. Though SpoIIB mutants can eventually complete engulfment, the process is significantly delayed and spatially unregulated .

Studies show that SpoIIB localizes to the sporulation septum during its biogenesis, distinguishing between active septal biogenesis sites and unused potential division sites within the same cell. This precise localization enables SpoIIB to perform its function in peptidoglycan processing at the correct time and location .

What are the optimal methods for expressing and purifying recombinant SpoIIB?

For recombinant expression of SpoIIB, an E. coli expression system using BL21(DE3) strain has proven effective for obtaining sufficient quantities of soluble protein. The following protocol is recommended based on successful approaches with similar sporulation proteins:

  • Clone the spoIIB gene into a pET vector system with an N-terminal His-tag

  • Transform into BL21(DE3) cells and induce with 0.5 mM IPTG at OD600 = 0.6

  • Express at 18°C overnight to enhance solubility

  • Lyse cells in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Purify using Ni-NTA affinity chromatography followed by size exclusion chromatography

For functional studies, it's important to consider that SpoIIB contains a potential transmembrane segment, which may affect solubility. Using detergents such as 0.1% Triton X-100 or 0.05% DDM during purification can help maintain protein stability and function .

How can researchers effectively visualize SpoIIB localization during sporulation?

Visualization of SpoIIB localization can be achieved through several complementary approaches:

How does the functional interaction between SpoIIB and other engulfment proteins mechanistically drive the engulfment process?

The engulfment process requires the coordinated action of multiple proteins, with SpoIIB working alongside SpoIID, SpoIIM, and SpoIIP to facilitate proper septal thinning and membrane migration. Current evidence suggests the following mechanism:

SpoIID, SpoIIP, and SpoIIM form a peptidoglycan degradation complex essential for engulfment. SpoIID is a membrane-anchored enzyme that degrades peptidoglycan and is targeted to the sporulation septum . While SpoIIB is not absolutely required for engulfment, it significantly enhances the efficiency and spatial regulation of this process .

SpoIIB appears to function by facilitating the rapid and spatially regulated dissolution of septal peptidoglycan. In SpoIIB mutants, electron microscopy reveals that septal peptidoglycan dissolution is delayed and spatially unregulated. Interestingly, the engulfing membranes still attempt to migrate around the remaining septal peptidoglycan, demonstrating that membrane migration can proceed even with incompletely degraded peptidoglycan, albeit inefficiently .

A working model suggests that SpoIIB enhances the activity or proper localization of the SpoIID/SpoIIP/SpoIIM complex, potentially by serving as a scaffold or by modifying the peptidoglycan structure to make it more accessible to degradation by this complex .

What is the significance of the genetic interaction between spoIIB and spoVG mutations?

The genetic interaction between spoIIB and spoVG presents an intriguing case of synthetic lethality in sporulation. While mutations in either gene alone cause only mild impairment of spore formation, combined mutations result in a severe block at stage II of sporulation (septum formation) .

This synthetic phenotype suggests that SpoIIB and SpoVG function in parallel pathways that can compensate for each other's loss. The mechanisms underlying this interaction remain unclear, as SpoVG does not appear to directly participate in engulfment . Current hypotheses include:

  • SpoVG may affect peptidoglycan synthesis or modification in a way that becomes critical in the absence of SpoIIB's peptidoglycan processing function.

  • Both proteins may contribute to septal structural integrity through different mechanisms, with the loss of both compromising septum stability beyond a critical threshold.

  • They may both regulate a common downstream process through different signaling pathways.

This genetic interaction highlights the complex regulatory networks governing sporulation and points to potential redundancy in mechanisms ensuring successful spore formation .

How can sloppy system analysis be applied to optimize experimental design for studying SpoIIB function?

Studying complex biological systems like sporulation presents challenges in experimental design due to the many parameters and potential sloppiness in the system. For SpoIIB research, applying sloppy system analysis can significantly improve experimental efficiency:

  • In designing experiments for SpoIIB function, researchers should recognize that many parameters may not need precise determination to make reliable predictions about key system behaviors. Instead, focus should be on identifying combinations of parameters that significantly affect observable outcomes .

  • Rather than attempting to precisely determine all parameters in the SpoIIB-related pathway, design experiments that reduce uncertainty in specific predictions of interest. For example, if interested in the rate of engulfment, focus experiments on parameters that most directly affect this outcome rather than trying to precisely characterize all protein-protein interactions .

  • Use computational modeling to identify which measurements will most effectively constrain predictions about system behavior. For SpoIIB studies, this might involve creating a model of engulfment that includes SpoIIB activity and then determining which experimental measurements would most efficiently improve model predictions .

  • Combine multiple measurement types (e.g., biochemical assays of SpoIIB activity, microscopy of engulfment dynamics, genetic epistasis analysis) to constrain model predictions from different angles, rather than focusing exclusively on one measurement approach .

How do SpoIIB protein levels affect the engulfment process and what factors regulate its expression?

SpoIIB protein levels have significant effects on engulfment efficiency. Based on studies of related proteins in the engulfment machinery, there appears to be a correlation between protein concentration and the rate of membrane migration during engulfment. For instance, with SpoIIP, areas with higher protein concentration showed faster membrane migration .

For SpoIIB specifically, several regulatory factors influence its expression and stability:

  • Transcriptional regulation: The spoIIB gene is under sporulation control, likely regulated by sporulation-specific sigma factors .

  • Protein stability: Like other sporulation proteins, SpoIIB levels may be regulated through proteolysis, with specific degradation pathways activated under certain conditions, similar to what has been observed with SpoIIE .

  • Localization-dependent stability: Some sporulation proteins show enhanced stability when properly localized. SpoIIB may similarly be protected from degradation when correctly positioned at the septum .

  • Protein-protein interactions: Complex formation with other engulfment proteins likely affects SpoIIB stability and activity levels. The study of SpoIIE showed that protein-protein interactions can protect against degradation .

Experimental evidence suggests that SpoIIB levels are substantially above the minimum required for engulfment, providing a buffer against fluctuations in protein expression .

What mechanisms govern the precise localization of SpoIIB to the sporulation septum?

SpoIIB exhibits remarkably specific localization to the sporulation septum during its biogenesis, even distinguishing between active septal biogenesis sites and unused potential division sites within the same cell . This precise localization appears to be governed by several mechanisms:

  • Interaction with the cell division machinery: SpoIIB likely interacts with components of the divisome during septum formation, similar to how SpoIIE interacts with FtsZ .

  • Recognition of peptidoglycan features: SpoIIB may recognize specific features of newly synthesized peptidoglycan at the developing septum.

  • Protein-protein interactions with other septum-localized proteins: SpoIIB may be recruited through interactions with other proteins already localized to the septum.

  • Dynamic localization cycles: Similar to SpoIID, SpoIIB may undergo activity-dependent cycles of binding and release from the septum. Studies with SpoIID showed that inactive mutants exhibited increased septal localization, suggesting that peptidoglycan degradation activity is coupled with release from the complex .

  • Membrane composition recognition: The sporulation septum may have distinct membrane composition that is recognized by the transmembrane segment of SpoIIB .

Unlike SpoIIE, which is initially distributed throughout the cell membrane before becoming concentrated at the asymmetric septum , SpoIIB appears to be directly targeted to sites of active septal biogenesis, suggesting different mechanisms of initial localization .

How does SpoIIB interact with the SpoIID/SpoIIP/SpoIIM engulfment complex at the molecular level?

The molecular interactions between SpoIIB and the SpoIID/SpoIIP/SpoIIM engulfment complex remain an area of active investigation. Based on current evidence, we can outline the following working model:

  • SpoIID, SpoIIP, and SpoIIM form a core complex essential for engulfment through their combined peptidoglycan degradation activities. SpoIID is a membrane-anchored enzyme that degrades peptidoglycan and is required throughout engulfment .

  • SpoIIB likely acts as an accessory protein to this complex, enhancing its efficiency and providing spatial regulation. The transient engulfment defect in spoIIB mutants compared to the complete block in spoIID, spoIIM, or spoIIP mutants supports this accessory role .

  • Molecular interaction studies suggest that SpoIIB may:

    • Facilitate recruitment or proper orientation of the SpoIID/SpoIIP/SpoIIM complex

    • Modify the peptidoglycan structure to enhance accessibility for the degradation complex

    • Regulate the activity of the complex through allosteric interactions

    • Contribute to the processivity of the complex as it moves along the septum

  • The interaction is likely dynamic, with SpoIIB potentially cycling between bound and unbound states depending on the peptidoglycan degradation activity of the complex, similar to what has been observed with SpoIID mutants .

  • The transmembrane segment of SpoIIB may facilitate interactions with the membrane-associated components of the SpoIID/SpoIIP/SpoIIM complex, positioning these proteins optimally relative to their peptidoglycan substrate .

How can structural biology approaches advance our understanding of SpoIIB function?

Structural biology approaches offer powerful tools to elucidate SpoIIB's function at the molecular level:

  • X-ray crystallography and cryo-EM: Determining the high-resolution structure of SpoIIB, both alone and in complex with interaction partners, would reveal:

    • Functional domains and active sites

    • Interaction interfaces with other engulfment proteins

    • Conformational changes associated with septal peptidoglycan binding

    • Potential mechanistic insights into how SpoIIB facilitates peptidoglycan dissolution

  • NMR spectroscopy: Particularly useful for studying dynamic regions of SpoIIB and mapping interaction surfaces with other proteins or peptidoglycan fragments. This could reveal how SpoIIB recognizes specific features of the sporulation septum.

  • Single-particle tracking: Combining structural information with single-molecule tracking in live cells could provide insights into the dynamics of SpoIIB during engulfment, revealing potential conformational changes or interaction cycles.

  • Molecular dynamics simulations: Using structural data to simulate how SpoIIB interacts with membranes and peptidoglycan at the atomic level, potentially revealing mechanisms of spatial regulation.

  • In silico docking studies: Predicting interactions between SpoIIB and other engulfment proteins based on structural data could guide targeted mutagenesis experiments to validate key interaction residues.

These approaches would significantly advance our understanding of how SpoIIB contributes to the spatiotemporal regulation of peptidoglycan dissolution during engulfment .

What insights can comparative analysis of SpoIIB across different Bacillus species provide about its evolutionary conservation and functional diversity?

Comparative genomic and functional analysis of SpoIIB across different Bacillus species and related genera could provide valuable insights:

  • Sequence conservation patterns: Identifying highly conserved regions across species would highlight functionally critical domains, while variable regions might indicate species-specific adaptations.

  • Co-evolution with other engulfment proteins: Analyzing whether changes in SpoIIB correlate with changes in SpoIID, SpoIIP, or SpoIIM could reveal functional interactions that have been maintained throughout evolution.

  • Functional complementation studies: Testing whether SpoIIB from different species can complement B. subtilis spoIIB mutants would reveal the degree of functional conservation and might identify species with enhanced or altered SpoIIB activities.

  • Correlation with engulfment efficiency: Species variations in engulfment speed or efficiency might correlate with specific SpoIIB sequence features, potentially identifying natural variants with optimized function.

  • Horizontal gene transfer events: Identifying potential horizontal transfer of spoIIB between bacterial lineages could provide insights into the evolutionary importance of this gene for sporulation efficiency.

Such comparative studies could not only enhance our understanding of SpoIIB's fundamental mechanisms but might also identify naturally optimized variants with potentially useful properties for biotechnological applications .

How can researchers overcome challenges in differentiating SpoIIB phenotypes from those of other engulfment proteins?

Differentiating the specific contribution of SpoIIB from other engulfment proteins presents several challenges, particularly given the partial redundancy and complex interactions in the engulfment machinery. The following approaches can help address these challenges:

  • Time-resolved analysis: The transient nature of the spoIIB mutant phenotype makes time-resolution critical. Use time-lapse microscopy with membrane stains like FM 4-64 to capture the dynamic process of engulfment, allowing detection of subtle delays or abnormalities that might be missed in endpoint analyses .

  • Quantitative phenotyping: Develop quantitative metrics for engulfment progression, such as measuring the angle of membrane migration or the frequency of bulging forespores. This allows detection of subtle phenotypic differences between spoIIB mutants and other engulfment mutants .

  • Epistasis analysis: Construct and analyze double and triple mutants with combinations of spoIIB, spoIID, spoIIM, and spoIIP mutations. The phenotypes of these combination mutants can reveal functional relationships between these proteins .

  • Protein localization studies: Simultaneously track the localization of multiple engulfment proteins using orthogonal fluorescent tags to determine whether SpoIIB affects the localization of other components of the engulfment machinery .

  • Biochemical activity assays: Develop in vitro assays for peptidoglycan modification that can distinguish the specific activity of SpoIIB from that of other engulfment proteins, similar to the approach used for SpoIID .

  • Specific antibiotics or inhibitors: Use compounds that target specific aspects of peptidoglycan synthesis or degradation to probe the precise role of SpoIIB in the context of other engulfment proteins.

What are the key considerations for designing mutations to study SpoIIB function without disrupting protein stability?

Designing mutations to study SpoIIB function requires careful consideration to avoid inadvertently destabilizing the protein. Based on studies with related proteins like SpoIID, consider the following approaches:

  • Targeted mutagenesis of conserved residues: Identify highly conserved amino acids across SpoIIB homologs, particularly those in predicted functional domains, as these are likely involved in activity rather than structural stability .

  • Stability prediction algorithms: Use computational tools to predict the effect of planned mutations on protein stability before experimental implementation.

  • Charge neutralization rather than charge reversal: When mutating charged residues, replace them with alanine (charge neutralization) rather than oppositely charged amino acids to minimize structural disruption .

  • Conservative substitutions for hydrophobic residues: Replace hydrophobic residues with similarly sized hydrophobic amino acids to maintain structural integrity.

  • Monitoring protein levels in vivo: For each mutation, quantify protein levels in vivo to identify potentially destabilizing mutations. In studies of SpoIID, mutations R106A and K203A were found to destabilize the protein in B. subtilis .

  • Domain-specific mutagenesis: Focus mutations on one domain at a time to minimize the risk of disrupting interdomain interactions critical for stability.

  • Protein tagging considerations: When creating fusion proteins for localization studies, use small epitope tags or fluorescent proteins with linkers to minimize interference with folding and stability .

By carefully designing mutations with these considerations in mind, researchers can more confidently attribute phenotypic effects to functional rather than structural disruptions of SpoIIB .

What are the most promising avenues for future research on SpoIIB and its role in bacterial sporulation?

Several promising research directions emerge from our current understanding of SpoIIB:

  • Structural characterization: Determining the high-resolution structure of SpoIIB would provide fundamental insights into its mechanism and facilitate structure-guided studies of its function in peptidoglycan processing.

  • Reconstitution of minimal engulfment systems: Reconstituting the engulfment machinery with purified components in artificial membrane systems could reveal the precise contributions of SpoIIB to the process and its interactions with other engulfment proteins.

  • Dynamics of engulfment complex assembly: Investigating how SpoIIB, SpoIID, SpoIIP, and SpoIIM assemble into functional complexes, including the temporal order of recruitment and potential conformational changes, would enhance our understanding of engulfment regulation.

  • Peptidoglycan substrate specificity: Determining whether SpoIIB recognizes specific features of septal peptidoglycan and how this contributes to the spatial regulation of peptidoglycan dissolution during engulfment.

  • Synthetic biology applications: Exploring whether engineered variants of SpoIIB with enhanced or modified activities could improve sporulation efficiency or be repurposed for biotechnological applications.

  • Connections to other cellular processes: Investigating potential roles of SpoIIB or its interactions beyond engulfment, such as in general cell wall metabolism or division site selection.

  • Therapeutic targeting: For pathogenic spore-forming bacteria, understanding whether SpoIIB represents a potential target for anti-sporulation therapeutics that could prevent spore formation without affecting vegetative growth.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.