Recombinant Bacillus subtilis Stage II sporulation protein Q (spoIIQ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
spoIIQ; ywnI; BSU36550; Stage II sporulation protein Q
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
spoIIQ
Target Protein Sequence
MREEEKKTSQVKKLQQFFRKRWVFPAIYLVSAAVILTAVLWYQSVSNDEVKDQLADNGGN SAYDNNDDAVEVGKSMENVAMPVVDSENVSVVKKFYETDAAKEEKEAALVTYNNTYSLSK GIDLAEKDGKDFDVSASLSGTVVKAEKDPVLGYVVEVEHADGLSTVYQSLSEVSVEQGDK VKQNQVIGKSGKNLYSEDSGNHVHFEIRKDGVAMNPLNFMDKPVSSIEKAATQETEESIQ QSSEKKDGSTEKGTEEKSGEKKDDSTDKSGSKESSTTEDTEQS
Uniprot No.

Target Background

Function
Recombinant *Bacillus subtilis* Stage II sporulation protein Q (SpoIIQ) is involved in forespore engulfment and is essential for anchoring membrane proteins to the forespore side of the septal membrane. It forms a channel with SpoIIIAH, open at the forespore end and gated at the mother cell end. This facilitates sigma-E-directed gene expression in the mother cell compartment of the sporangium, triggering the activation of sigma-G forespore-specific gene expression via intercellular signaling.
Gene References Into Functions
  1. SpoIIQ specifically optimizes sigma(G) activity within a novel regulatory circuit, preventing sigma(G) from activating transcription of the gene encoding its inhibitor, the anti-sigma factor CsfB. PMID: 26929302
  2. SpoIIQ undergoes sigmaG-independent, engulfment-dependent proteolysis mediated by SpoIVB. PMID: 16164552
Database Links
Subcellular Location
Forespore membrane; Single-pass membrane protein. Note=Localizes to the engulfing septal membranes.

Q&A

What is SpoIIQ and what role does it play in Bacillus subtilis sporulation?

SpoIIQ is a membrane-bound protein encoded by the spoIIQ gene that is specifically expressed in the forespore compartment during the early stages of Bacillus subtilis sporulation. This protein plays a crucial role in the engulfment process, which is a phagocytosis-like event where the larger mother cell progressively engulfs the adjacent smaller forespore, ultimately creating a cell within a cell structure. SpoIIQ is initially targeted to the septum at the boundary between the two cells and then progressively spreads around the entire membrane of the forespore as engulfment proceeds. The proper localization and function of SpoIIQ are essential for the completion of late-stage engulfment, making it a critical component in the transformation of an actively growing B. subtilis cell into a dormant, stress-resistant spore . Mutations in spoIIQ lead to defects in engulfment, highlighting its necessary role in this morphogenetic process that is fundamental to bacterial sporulation.

How does the structure of SpoIIQ relate to its function in sporulation?

The SpoIIQ protein exhibits a domain architecture that directly supports its role in sporulation. The N-terminal portion of SpoIIQ, specifically the first 52 amino acid residues, contains sequences that are necessary and sufficient for proper septum targeting at the boundary between the mother cell and forespore . This region likely contains membrane-spanning domains that anchor the protein to the forespore membrane. The C-terminal domain of SpoIIQ extends into the space between the mother cell and forespore membranes, where it can interact with proteins expressed in the mother cell, particularly SpoIIIAH. These structural features enable SpoIIQ to function as part of a molecular complex that spans the intermembrane space during engulfment. The protein's ability to form multimers that track along the engulfing mother cell membrane is crucial for its proposed function as part of a Brownian "ratchet" mechanism that helps power the engulfment process . Understanding this structure-function relationship is essential for researchers designing experiments to investigate the molecular mechanisms of sporulation.

What is the regulatory pathway controlling SpoIIQ expression and activity?

SpoIIQ expression is under compartment-specific regulation within the developing forespore during Bacillus subtilis sporulation. The gene is transcribed specifically in the forespore compartment under the control of the early forespore-specific sigma factor, σF. This compartmentalization ensures that SpoIIQ is only expressed in the forespore where it is needed to coordinate with mother cell proteins during engulfment. Beyond transcriptional regulation, SpoIIQ activity is also controlled at the post-translational level. Research has demonstrated that SpoIIQ is subject to σG-independent but engulfment-dependent proteolysis that depends on the SpoIVB protease . This regulatory mechanism creates a checkpoint linking the physical process of engulfment with the proteolytic processing of SpoIIQ. The proteolytic regulation may serve as a quality control step ensuring that engulfment proceeds correctly before downstream sporulation events are triggered. This multi-layered regulation highlights the sophisticated control mechanisms that ensure the proper timing and execution of the sporulation program in B. subtilis.

What are the most effective methods for expressing and purifying recombinant SpoIIQ protein?

For effective expression and purification of recombinant SpoIIQ, researchers should consider both the expression system and purification strategy carefully. When using B. subtilis as an expression host, a strong promoter such as Pgrac212 can drive high-level expression of the target protein . Culture conditions should be optimized by growing B. subtilis strains in LB medium to the mid-log growth phase (OD600 reaching 0.8–1), as this typically represents the optimal balance between cell density and protein expression. For sample collection, harvesting cells equivalent to an OD600 of 2.4 by centrifugation at 13,000 g for 5 minutes provides consistent results . Cell lysis can be achieved using a buffer containing lysozyme, which is particularly effective for B. subtilis cells. For purification, a combination of affinity chromatography (using histidine tags) followed by size-exclusion chromatography yields highly pure protein. When expressing membrane proteins like SpoIIQ, it's crucial to include appropriate detergents in the purification buffers to maintain protein solubility and native conformation. Researchers should validate protein purity and integrity using SDS-PAGE and western blotting techniques, following protocols that include appropriate sample preparation and gel running conditions as outlined in standardized B. subtilis protein analysis methods .

How can researchers effectively visualize SpoIIQ localization during the sporulation process?

Visualizing SpoIIQ localization during sporulation requires specialized techniques that preserve spatial information while providing sufficient resolution to track protein movement. Immunofluorescence microscopy using antibodies specific to SpoIIQ has proven effective in tracking its initial localization to the septum and subsequent spread around the forespore membrane during engulfment . For this approach, cells must be fixed and permeabilized carefully to maintain morphological integrity while allowing antibody access. Alternatively, researchers can create fluorescent protein fusions (such as GFP-SpoIIQ) for live-cell imaging, which allows for dynamic tracking of SpoIIQ movement during the engulfment process. When designing such constructs, it's critical to ensure that the fluorescent tag doesn't interfere with protein function or localization by performing complementation studies with the tagged protein in spoIIQ mutant backgrounds. Super-resolution microscopy techniques such as structured illumination microscopy (SIM) or stochastic optical reconstruction microscopy (STORM) can provide enhanced resolution to better visualize the distinct membrane localization patterns. Time-lapse microscopy combined with these approaches allows researchers to track the dynamics of SpoIIQ localization throughout the entire sporulation process, providing valuable insights into the temporal aspects of engulfment progression.

What genetic tools are available for studying SpoIIQ function in Bacillus subtilis?

A comprehensive toolkit for genetic manipulation of spoIIQ in B. subtilis has been developed to facilitate functional studies. For gene deletion studies, researchers can construct clean knockout mutants using homologous recombination-based techniques that replace the spoIIQ gene with antibiotic resistance markers. These mutants are valuable for assessing the phenotypic consequences of complete loss of SpoIIQ function, particularly in engulfment completion and heat-resistant spore formation . For more nuanced functional analysis, domain deletion mutants can be created to identify specific regions required for particular aspects of SpoIIQ function, such as the N-terminal 52 residues needed for septum targeting . Site-directed mutagenesis approaches allow for the introduction of specific amino acid changes to test hypotheses about particular residues involved in protein interactions or function. Complementation studies, where wildtype or mutated versions of spoIIQ are introduced into a knockout background, provide critical evidence for the functionality of modified proteins. Additionally, conditional expression systems utilizing inducible promoters enable researchers to control the timing and level of SpoIIQ expression, which is particularly useful for studying rate-limiting steps in engulfment. Integration of these genetic tools with microscopy and biochemical approaches provides a powerful platform for dissecting the multiple facets of SpoIIQ function during sporulation.

How does the SpoIIQ-SpoIIIAH complex function as a molecular machine during engulfment?

The SpoIIQ-SpoIIIAH complex forms a remarkable molecular machine that spans the intermembrane space between the forespore and mother cell during sporulation. This complex functions through a proposed "ratchet" mechanism that generates force to drive membrane movement during engulfment . SpoIIQ, expressed in the forespore, interacts directly with SpoIIIAH, a mother cell protein, creating a zipper-like connection across the two cells that physically tethers the engulfing membranes. Experimental evidence from photobleaching studies indicates that SpoIIQ multimers do not freely diffuse once assembled, suggesting they form stable anchoring points that facilitate unidirectional membrane movement . The complex appears to work in coordination with the "DMP machine" (comprising SpoIID, SpoIIM, and SpoIIP proteins) that hydrolyzes peptidoglycan between the membranes, with both systems potentially functioning in partially redundant pathways to ensure successful engulfment . Interestingly, when the septal peptidoglycan is enzymatically removed by lysozyme, cells can still complete engulfment through the action of the SpoIIQ-SpoIIIAH complex alone, highlighting the mechanical force-generating capability of this protein interaction . Recent research suggests a model where different engulfment mechanisms may operate at distinct stages: the DMP machine initiating early membrane movement, the SpoIIQ-SpoIIIAH complex driving the majority of membrane migration, and peptidoglycan synthesis facilitating the final membrane fission event that separates the forespore from the mother cell .

What is the relationship between SpoIIQ function and irreversible commitment to sporulation?

The relationship between SpoIIQ function and the cell's irreversible commitment to sporulation represents a fundamental aspect of bacterial development decision-making. Research has demonstrated that SpoIIQ plays a critical role in establishing the point of no return during sporulation, after which cells cannot revert to vegetative growth even if nutrient conditions improve. Experimental evidence shows that forespores exhibit rod-like, longitudinal growth in the presence of nutrients only when both SpoIIQ and SpoIIP are absent, indicating that once these proteins are active, the forespore becomes irreversibly committed to the sporulation pathway . This finding suggests that the physical tethering and membrane remodeling activities of SpoIIQ establish morphological constraints that prevent the cell from returning to vegetative growth. The timing of this commitment point coincides with the initiation of engulfment, a process that requires coordinated activities in both the forespore and mother cell compartments. By participating in the engulfment machinery, SpoIIQ helps establish physical changes to cell architecture that lock the cell into the sporulation pathway. This irreversible commitment mechanism provides an elegant solution to the biological challenge of developmental decision-making, ensuring that once significant resources have been invested in the sporulation process, the cell completes the program rather than abandoning it when transient improvements in environmental conditions occur. Understanding this commitment point has broader implications for studying bacterial persistence strategies and developmental biology across systems.

How should researchers interpret conflicting data about SpoIIQ function in different experimental systems?

When faced with conflicting data about SpoIIQ function across different experimental systems, researchers should adopt a systematic analytical approach that considers several key factors. First, differences in genetic backgrounds of bacterial strains can significantly impact protein function, as secondary mutations or strain-specific gene expression patterns may mask or modulate SpoIIQ phenotypes. Second, variations in experimental conditions, including media composition, induction methods for sporulation, and temperature, can dramatically affect the sporulation process and thus the apparent function of SpoIIQ. For example, discrepancies have been observed between nutrient starvation and resuspension methods of inducing sporulation, with spoIIQ mutants showing different engulfment phenotypes depending on the induction method . Third, the choice of analytical techniques introduces technical variables that must be considered – immunofluorescence versus fluorescent protein fusions, or different fixation protocols for electron microscopy, can yield apparently contradictory results about protein localization or function. When evaluating conflicting literature, researchers should carefully compare the methodological details to identify these potential sources of variation. A productive approach is to replicate key experiments using multiple techniques and under standardized conditions that bridge different experimental systems. Rather than viewing conflicting data as problematic, researchers should see it as an opportunity to discover context-dependent aspects of SpoIIQ function that may reveal new biological insights about the regulation and adaptability of the sporulation process.

What quantitative methods can be used to analyze SpoIIQ-dependent engulfment efficiency?

Quantitative analysis of SpoIIQ-dependent engulfment efficiency requires robust methodologies that can accurately measure this complex morphological process. Researchers can employ several complementary approaches to generate reliable quantitative data. Fluorescence microscopy using membrane dyes or fluorescent membrane proteins allows for the classification of cells into distinct engulfment stages (e.g., no engulfment, partial engulfment, complete engulfment), with hundreds of cells counted to generate statistically significant proportions for each category. Time-lapse microscopy enables the calculation of engulfment rates by measuring the progression of membrane movement over time, providing kinetic parameters that can be compared between wildtype and mutant strains. Electron microscopy offers higher resolution assessment of engulfment stages, though with lower throughput, and can be quantified by measuring the angle of membrane migration around the forespore or the percentage of forespore circumference that has been engulfed. For population-level analysis, researchers can quantify heat-resistant spore formation as an indirect measure of successful engulfment completion, since engulfment defects typically result in reduced spore yields . Advanced image analysis algorithms can automate the quantification process, reducing bias and increasing throughput. When designing quantitative experiments, it is essential to include appropriate controls, such as known engulfment-defective mutants (e.g., spoIID, spoIIM, or spoIIP mutants) as negative controls, and complemented strains to confirm phenotype specificity. Statistical analysis should include appropriate tests to determine the significance of observed differences, with multiple biological replicates to ensure reproducibility.

How can proteomics approaches be used to study SpoIIQ interactions and modifications during sporulation?

Proteomics approaches offer powerful tools for comprehensively mapping SpoIIQ interactions and post-translational modifications throughout the sporulation process. Co-immunoprecipitation coupled with mass spectrometry (Co-IP-MS) can identify proteins that physically interact with SpoIIQ at different stages of sporulation, revealing temporal changes in the composition of SpoIIQ-containing complexes. For this approach, researchers should use epitope-tagged SpoIIQ constructs that have been verified to function normally in complementation studies. Proximity-dependent labeling methods, such as BioID or APEX, can identify proteins in close spatial proximity to SpoIIQ in living cells, potentially capturing transient interactions that might be missed by co-IP. To study post-translational modifications, targeted mass spectrometry can identify and quantify specific modifications such as the engulfment-dependent proteolysis mediated by SpoIVB . Phosphoproteomics can reveal potential regulatory phosphorylation sites on SpoIIQ that might control its function or interactions. Crosslinking mass spectrometry (XL-MS) provides information about specific contact sites between SpoIIQ and its binding partners, generating detailed structural insights about complex formation with proteins like SpoIIIAH . When applying these techniques to sporulating cultures, it's essential to synchronize sporulation and collect samples at defined time points to capture the dynamic changes in the SpoIIQ interactome throughout the process. Comparative analyses between wildtype and mutant strains (e.g., spoIVB mutants or engulfment-defective mutants) can reveal how specific genetic perturbations affect the SpoIIQ interaction network. Integration of proteomics data with genetic, microscopy, and biochemical results generates a comprehensive understanding of how SpoIIQ functions within the complex sporulation machinery.

How can recombinant SpoIIQ be utilized in vaccine development strategies?

Recombinant SpoIIQ offers promising applications in vaccine development, particularly as part of Bacillus subtilis-based vaccine delivery systems. B. subtilis has several advantages as a vaccine vector, including its status as a Generally Recognized As Safe (GRAS) organism, its ability to form heat-stable spores for vaccine stability, and its natural immunostimulatory properties . SpoIIQ, as a spore-associated protein, can be engineered as a fusion partner for vaccine antigens, potentially allowing display of these antigens on the spore surface or incorporation into the spore structure. The expression systems developed for producing recombinant proteins in B. subtilis, such as the strong Pgrac212 promoter system, can be adapted for high-level expression of SpoIIQ-antigen fusions . Research with recombinant B. subtilis expressing influenza hemagglutinin (HA) has demonstrated that orally administered recombinant B. subtilis can induce robust immune responses, including elevated specific IgA titers in the trachea and IgG and HI antibody titers in serum . Similar approaches could be applied using SpoIIQ as a carrier or display protein. A key advantage of this approach is the ability to induce mucosal immunity, which is particularly important for pathogens that infect via mucosal routes. When developing SpoIIQ-based vaccine strategies, researchers should carefully evaluate the impact of fusion constructs on sporulation efficiency, antigen stability, and immune presentation, as well as conducting thorough immunogenicity and protection studies in appropriate animal models.

What new technologies might advance our understanding of SpoIIQ dynamics during sporulation?

Emerging technologies offer exciting possibilities for deeper insights into SpoIIQ dynamics during sporulation. Single-molecule tracking techniques, coupled with super-resolution microscopy, could reveal the nanoscale movements and clustering behaviors of individual SpoIIQ molecules during engulfment, providing unprecedented detail about the proposed ratchet mechanism. Cryo-electron tomography has the potential to visualize the three-dimensional architecture of the engulfment machinery, including the SpoIIQ-SpoIIIAH complex, in near-native conditions within intact sporulating cells. For studying protein-protein interactions, techniques like Förster Resonance Energy Transfer (FRET) between fluorescently labeled SpoIIQ and interaction partners could provide real-time information about complex formation during live sporulation. Microfluidics platforms that allow precise control of the microenvironment around individual sporulating cells would enable researchers to study how environmental fluctuations affect SpoIIQ function and localization with single-cell resolution. CRISPR-based gene editing technologies could facilitate more precise and efficient genetic manipulation of spoIIQ, allowing for rapid testing of structure-function hypotheses. Advanced computational modeling approaches could integrate experimental data to simulate the biophysical forces generated by SpoIIQ-containing complexes during membrane movement. Expansion microscopy, which physically enlarges specimens while maintaining relative spatial relationships, could provide enhanced visualization of the narrow intermembrane space where SpoIIQ functions. The application of these cutting-edge technologies, particularly in combination, promises to resolve current controversies and reveal new aspects of SpoIIQ biology that have remained inaccessible with conventional approaches.

How might knowledge of SpoIIQ function inform strategies to control sporulation in pathogenic spore-formers?

Understanding SpoIIQ function presents strategic opportunities for controlling sporulation in pathogenic spore-forming bacteria, with significant implications for preventing and treating diseases caused by organisms like Clostridium difficile, Bacillus anthracis, and Clostridium perfringens. Research has demonstrated that inhibiting SpoIIQ, SpoIIIAA, or SpoIIIAH function could prevent the formation of infectious C. difficile spores and thus disease transmission . This knowledge could guide the development of anti-sporulation compounds that specifically target the SpoIIQ-SpoIIIAH interaction interface, disrupting the engulfment process and preventing the production of mature, infectious spores. Such targeted anti-sporulation strategies would be particularly valuable for C. difficile infections, where preventing spore formation could reduce recurrence rates by limiting environmental persistence. The species-specific differences in SpoIIQ function and regulation between B. subtilis and C. difficile suggest that it may be possible to develop inhibitors that selectively target pathogenic spore-formers while sparing beneficial bacteria. Structure-based drug design approaches, informed by detailed structural characterization of SpoIIQ from various species, could yield small molecules that disrupt critical protein-protein interactions required for engulfment. Additionally, peptide inhibitors derived from the interaction domains of SpoIIQ or SpoIIIAH could serve as competitive inhibitors of complex formation. For clinical applications, combination therapies that pair conventional antibiotics with anti-sporulation compounds targeting SpoIIQ function could potentially reduce the risk of recurrent infections by eliminating both vegetative cells and preventing the formation of new resistant spores. As research progresses, high-throughput screening systems could be developed to identify compounds that specifically interfere with SpoIIQ function across different pathogenic species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.