Recombinant Bacillus subtilis Stage II sporulation protein SA (spoIISA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us for preferential development.
Synonyms
spoIISA; ykaC; BSU12830; Stage II sporulation protein SA; Killer protein SpoIISA; Toxin SpoIISA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
spoIISA
Target Protein Sequence
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSL FTHWERYLIVAVSFALIDAFIFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTY QYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASLCHYSTQADKDRLTEHMDDPA DVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL PIEEEGEG
Uniprot No.

Target Background

Function
SpoIISA is a toxic component of a type II toxin-antitoxin (TA) system. Its toxicity is neutralized by the cognate antitoxin SpoIISB. In the absence of SpoIISB, SpoIISA expression leads to sporulation arrest at stage II, characterized by plasmolysis zones, peptidoglycan layer disruption, and cell death. SpoIISA is lethal when synthesized during vegetative growth without SpoIISB. In *E. coli*, both the membrane-bound and soluble domains are required in cis for its toxic activity.
Gene References Into Functions
  1. Studies using truncated SpoIISA constructs demonstrate that the entire transmembrane domain is essential for toxicity. PMID: 25039482
  2. SpoIISA levels increase during stationary phase and localize to the cytoplasmic membrane. PMID: 20863891
Database Links
Protein Families
SpoIISA toxin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SpoIISA and what is its role in Bacillus subtilis?

SpoIISA is a membrane protein encoded by the spoIISAB operon in Bacillus subtilis that functions as a toxin in a toxin-antitoxin system. It contains three putative membrane-spanning segments and a cytoplasmic domain . The protein plays a significant role during sporulation, particularly after asymmetric septation occurs. Inappropriate expression of SpoIISA in the absence of its antitoxin SpoIISB causes cell envelope damage and death, indicating its role as a cell killer protein .

Research has shown that SpoIISA is present in vegetatively growing cells and its levels increase during growth on sporulation medium, although this increase is not dependent on Spo0A, a key sporulation regulator . The toxicity of SpoIISA appears to be compartment-specific, manifesting primarily in the mother cell compartment during sporulation, which suggests the existence of compartment-specific activators or inhibitors of SpoIISA activity .

How does the SpoIISA-SpoIISB toxin-antitoxin system function?

The SpoIISA-SpoIISB system operates as a chromosomally encoded toxin-antitoxin (TA) system in B. subtilis. SpoIISA functions as the toxin component that, when expressed without SpoIISB, causes cell death through membrane damage. SpoIISB acts as the antitoxin, neutralizing the toxic effects of SpoIISA .

Structurally, the cytoplasmic fragment of SpoIISA (CSpoIISA) forms a complex with SpoIISB in a CSpoIISA₂·SpoIISB₂ heterotetramer configuration. The CSpoIISA has a single domain α/β structure resembling a GAF domain with an extended α-helix at its N terminus, while SpoIISB is a natively disordered protein that adopts structure only in the presence of CSpoIISA . The two CSpoIISA protomers form extensive interactions through an intermolecular four-helix bundle, and each SpoIISB chain wraps around the CSpoIISA dimer, forming extensive interactions with both CSpoIISA protomers .

The stability of this complex is significant, with surface plasmon resonance experiments revealing a dissociation constant in the nanomolar range . This strong interaction ensures effective neutralization of SpoIISA's toxic effects when SpoIISB is present.

What experimental approaches are used to study SpoIISA-SpoIISB interactions?

Researchers employ several experimental approaches to study SpoIISA-SpoIISB interactions:

  • Crystallographic Studies: X-ray crystallography has been used to determine the structure of the cytoplasmic fragment of SpoIISA in complex with SpoIISB. This technique revealed a CSpoIISA₂·SpoIISB₂ heterotetramer and provided insights into the structural basis of their interaction .

  • Spectroscopic Methods: Circular dichroism (CD) spectroscopy has been employed to demonstrate that SpoIISB is a natively disordered protein that adopts structure only when bound to CSpoIISA .

  • Surface Plasmon Resonance (SPR): SPR experiments have been used to determine the binding affinity between CSpoIISA and SpoIISB, revealing a stable complex with a dissociation constant in the nanomolar range .

  • Genetic Manipulation and Phenotypic Analysis: Researchers have created mutant strains with various deletions or modifications in the spoIISA and spoIISB genes to study their functions in vivo. Sporulation efficiency measurements in these mutants provide valuable insights into the functional importance of specific regions of these proteins .

These approaches collectively provide a comprehensive understanding of the SpoIISA-SpoIISB interaction at molecular, structural, and functional levels.

How do structural features of SpoIISA relate to its toxicity mechanism?

The toxicity mechanism of SpoIISA is closely linked to its structural organization. The protein contains three putative membrane-spanning segments and a cytoplasmic domain . The membrane-spanning regions likely play a crucial role in SpoIISA's ability to disrupt cell membrane integrity, which appears to be its primary mechanism of toxicity.

The cytoplasmic domain of SpoIISA (CSpoIISA) forms a dimer with an α/β structure resembling a GAF domain and an extended α-helix at its N terminus . The two CSpoIISA protomers form extensive interactions through an intermolecular four-helix bundle . This structural arrangement may be important for the protein's function, possibly by facilitating interactions with other cellular components or by enabling conformational changes that trigger membrane disruption.

Research suggests that SpoIISA's toxicity is specifically manifested in the mother cell compartment during sporulation, and the protein targets the cell membrane as evidenced by immunolocalization studies and GFP fusion experiments . The sporulation septum, which has a distinct structure appearing thinner than the vegetative septum, may be particularly vulnerable to SpoIISA-mediated disruption .

Understanding how these structural features contribute to SpoIISA's toxicity requires further investigation using site-directed mutagenesis, domain-swapping experiments, and detailed biochemical characterization of the membrane-associated activities of the protein.

What critical residues in SpoIISB are essential for neutralizing SpoIISA toxicity?

Deletion mutagenesis studies of SpoIISB have provided valuable insights into the critical regions required for its antitoxin function. The C-terminal region of SpoIISB is particularly important for neutralizing SpoIISA toxicity. Experimental data shows that deletion of as few as four C-terminal residues of SpoIISB leads to a complete loss of its capacity to overcome SpoIISA toxicity .

In contrast, the N-terminal region appears to be more dispensable. Deletion analysis indicated that the N-terminal 12 residues of SpoIISB are not essential for its antitoxin activity in vivo . Interestingly, this includes Cys9', suggesting that the disulfide bridge is probably not critical for the antidote function .

The table below summarizes the effects of various SpoIISB deletions on sporulation efficiency, which serves as an indicator of SpoIISB's ability to neutralize SpoIISA toxicity:

SpoIISB VariantSporulation Efficiency (spores/ml)Antitoxin Activity
Wild type4.1 × 10⁸Present
No SpoIISB (SpoIISA only)1.6 × 10³Absent
N-terminal Δ32.9 × 10⁸Present
N-terminal Δ128.4 × 10⁸Present
N-terminal Δ278.3 × 10³Absent
N-terminal Δ368.3 × 10³Absent
C-terminal Δ44.8 × 10³Absent
C-terminal Δ86.6 × 10³Absent
C-terminal Δ125.7 × 10³Absent
C-terminal Δ169.5 × 10³Absent

These findings suggest that while the extreme N-terminus is dispensable, the C-terminus of SpoIISB is absolutely essential for its antitoxin function, likely due to its role in forming critical interactions with SpoIISA .

How does the cellular localization of SpoIISA influence its function during sporulation?

The cellular localization of SpoIISA plays a crucial role in its function during sporulation. Immunolocalization studies and GFP fusion experiments have confirmed that SpoIISA is targeted to the cell membrane . This membrane localization is consistent with the protein's structure, which includes three putative membrane-spanning segments .

During sporulation, B. subtilis cells undergo asymmetric division, forming a smaller forespore and a larger mother cell. Although SpoIISA would be expected to partition into both compartments upon asymmetric cell division, its toxicity is selectively manifested in the mother cell . This compartment-specific activity suggests the existence of unidentified compartment-specific activators or inhibitors of SpoIISA function.

The sporulation septum has a distinct structure, appearing thinner than the vegetative septum, which may make it particularly vulnerable to SpoIISA-mediated membrane disruption . This vulnerability could explain why SpoIISA toxicity becomes evident specifically after the completion of the asymmetric septum.

Understanding the precise mechanisms governing the compartment-specific activity of SpoIISA requires further investigation, including detailed analysis of protein trafficking during sporulation and identification of potential regulatory factors that modulate SpoIISA activity in different cellular compartments.

What experimental design is optimal for studying SpoIISA-SpoIISB interactions in vitro?

An optimal experimental design for studying SpoIISA-SpoIISB interactions in vitro should incorporate multiple complementary approaches:

  • Protein Expression and Purification:

    • Express recombinant versions of SpoIISA (particularly the cytoplasmic domain) and SpoIISB with affinity tags for purification.

    • Use a bacterial expression system such as E. coli for high-yield protein production.

    • Employ affinity chromatography followed by size-exclusion chromatography to obtain pure protein samples .

  • Structural Analysis:

    • X-ray crystallography to determine high-resolution structures of the proteins and their complexes.

    • NMR spectroscopy for studying dynamic aspects of the interaction.

    • Cryo-electron microscopy for visualizing larger assemblies or membrane-associated structures .

  • Interaction Analysis:

    • Surface plasmon resonance (SPR) to measure binding kinetics and determine dissociation constants.

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of binding.

    • Fluorescence-based assays (such as FRET) to monitor interactions in real-time .

  • Functional Assays:

    • In vitro membrane disruption assays using liposomes to assess SpoIISA's membrane-perturbing activity.

    • Counteraction assays to evaluate SpoIISB's ability to neutralize SpoIISA-mediated effects.

  • Mutagenesis Studies:

    • Site-directed mutagenesis to identify critical residues involved in the interaction.

    • Truncation variants to map interaction domains .

This multi-faceted approach follows good experimental design principles by controlling variables, establishing clear hypotheses about interaction mechanisms, and employing both between-subjects (comparing different protein variants) and within-subjects (testing the same proteins under various conditions) experimental paradigms .

When designing these experiments, researchers should maintain rigorous controls, including:

  • Negative controls (non-interacting protein pairs)

  • Positive controls (known interacting domains)

  • Vehicle controls for solvents or buffer components

  • Temperature and pH controls to assess environmental effects on interactions

This comprehensive design ensures robust characterization of the SpoIISA-SpoIISB interaction at molecular, structural, and functional levels.

How can researchers effectively express and purify recombinant SpoIISA for structural studies?

Effective expression and purification of recombinant SpoIISA for structural studies requires careful consideration of the protein's properties, particularly its membrane-spanning domains. A recommended protocol includes:

  • Construct Design:

    • For full-length SpoIISA: Use specialized vectors designed for membrane protein expression.

    • For the cytoplasmic domain (CSpoIISA): Design constructs excluding the membrane-spanning segments to improve solubility.

    • Include affinity tags (His₆, GST, or MBP) preferably with a cleavable linker to aid purification .

  • Expression System Selection:

    • For the cytoplasmic domain: Standard E. coli strains (BL21(DE3) or derivatives) are suitable.

    • For full-length protein: Consider specialized strains designed for membrane protein expression or eukaryotic systems like yeast or insect cells.

    • Use selenomethionine labeling for experimental phasing in crystallography as demonstrated in previous studies .

  • Expression Conditions:

    • Optimize temperature (typically 16-25°C for membrane proteins)

    • Use low inducer concentrations for slower expression

    • Consider auto-induction media for gradual protein production

    • Co-express with SpoIISB if toxicity is an issue

  • Extraction and Solubilization:

    • For full-length SpoIISA: Use appropriate detergents (DDM, LMNG, or other mild detergents) for membrane extraction

    • For CSpoIISA: Standard lysis buffers are likely sufficient

    • Include protease inhibitors to prevent degradation

  • Purification Strategy:

    • Initial capture: Affinity chromatography (IMAC for His-tagged proteins)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • For crystallization: Remove affinity tags via protease cleavage

  • Quality Control:

    • SDS-PAGE and Western blotting to assess purity and identity

    • Dynamic light scattering to check for aggregation

    • Mass spectrometry to confirm protein integrity

    • Circular dichroism to verify proper folding

  • Complex Formation with SpoIISB:

    • If studying the complex, purify SpoIISB separately (noting it's natively disordered)

    • Form the complex by mixing purified components at appropriate molar ratios

    • Verify complex formation by size exclusion chromatography

This approach has been successfully used to produce the CSpoIISA-SpoIISB complex for crystallographic studies, yielding high-resolution structural information about this toxin-antitoxin system .

What in vivo experimental approaches can assess SpoIISA functionality in Bacillus subtilis?

To assess SpoIISA functionality in Bacillus subtilis, researchers can employ several in vivo experimental approaches:

  • Genetic Manipulation and Phenotypic Analysis:

    • Gene deletion studies: Create clean knockouts of spoIISA and measure effects on growth and sporulation

    • Complementation assays: Reintroduce wild-type or mutant versions of spoIISA in knockout strains

    • Conditional expression systems: Use inducible promoters to control SpoIISA expression levels and timing

  • Sporulation Efficiency Measurements:

    • Quantify spore formation under various conditions using methods such as:

      • Heat-resistance assays (counting colonies after heat treatment)

      • Microscopic counting of phase-bright spores

      • Flow cytometry with appropriate staining

    • This approach has been effectively used to demonstrate that SpoIISA inactivation in a spoIISB null mutant background fully restores sporulation

  • Compartment-Specific Expression:

    • Use compartment-specific promoters to express SpoIISA selectively in either the mother cell or forespore

    • Evaluate compartment-specific effects using reporter systems or microscopy

    • Previous research has shown that forced expression of SpoIISA in the forespore leads to morphological defects and cell death

  • Microscopy-Based Approaches:

    • Fluorescence microscopy using SpoIISA-GFP fusions to track localization

    • Time-lapse microscopy to observe dynamic changes during sporulation

    • Electron microscopy to examine membrane and septum integrity

    • Immunolocalization studies to detect native protein distribution

  • Protein-Protein Interaction Studies:

    • Bacterial two-hybrid assays to identify interaction partners

    • Co-immunoprecipitation to verify interactions in vivo

    • FRET-based approaches for real-time monitoring of interactions

  • Membrane Integrity Assays:

    • Membrane permeability tests using fluorescent dyes

    • Ion leakage measurements

    • Membrane potential monitoring using voltage-sensitive dyes

  • Experimental Design Considerations:

    • Between-subjects design: Compare different strains (wild-type, mutants, complemented strains)

    • Within-subjects design: Monitor the same cells over time

    • Control for extraneous variables by maintaining consistent:

      • Growth conditions

      • Sporulation induction methods

      • Genetic background

      • Sampling times

These approaches, when implemented with appropriate controls and statistical analyses, provide a comprehensive assessment of SpoIISA functionality in its native cellular context and reveal how it contributes to the complex process of sporulation in B. subtilis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.