Recombinant Bacillus subtilis Stage III sporulation protein AD (spoIIIAD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
spoIIIAD; BSU24400; Stage III sporulation protein AD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-133
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
spoIIIAD
Target Protein Sequence
MQIDIVQIVGLGLIATFLSLIVKEQKPTFAFLIVVFAGCAIFLYLVDQIYDIIRMIEKIA INANVNMVYVETILKIIGIAYIAEFGAQLTKDAGQGAIASKIELAGKILILVMAVPILTV IIETILGLIPSMS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SpoIIIAD and its role in B. subtilis sporulation?

SpoIIIAD is one of eight proteins (SpoIIIAA to SpoIIIAH) encoded by the spoIIIA locus in Bacillus subtilis that are essential for proper endospore formation. These proteins are expressed in the mother cell during sporulation and are critical for the activation of σG in the forespore compartment . SpoIIIAD functions as part of a complex system that helps maintain proper communication between the mother cell and developing forespore, ensuring proper developmental progression during the sporulation process.

Within the spoIIIA operon architecture, SpoIIIAD occupies a specific position that suggests its participation in the coordinated expression and assembly of the spoIIIA-encoded machinery. The arrangement of genes in this operon reflects evolutionary optimization for the precise timing and stoichiometry required during the complex sporulation process .

How is the spoIIIA locus organized and regulated?

The spoIIIA locus features a complex transcriptional organization with at least two promoters that drive expression:

  • Primary promoter (P1 spoIIIA): Located at the beginning of the locus, upstream of spoIIIAA

  • Secondary internal promoter (P2): Located within spoIIIAF, driving expression of spoIIIAG and spoIIIAH

The P2 promoter is particularly interesting as it is:

  • Transcribed by σE-RNA polymerase

  • Repressed by SpoIIID

  • Approximately twice as active as the P1 promoter

  • Essential for sporulation, as inactivation of P2 blocks spore formation

This dual-promoter system ensures appropriate expression levels of all eight proteins in the operon while providing regulatory flexibility during the sporulation process.

What experimental evidence supports the function of SpoIIIAD?

Studies have employed various genetic and molecular approaches to elucidate SpoIIIAD function:

Experimental ApproachKey FindingsMethodological Notes
Deletion studiesSpoIIIAD deletion prevents proper sporulationComplementation studies with ectopic expression required to confirm specificity
Transcriptional fusionsIdentified the P2 promoter within spoIIIAFUsed lacZ reporter constructs to measure promoter activity during sporulation
Primer extension assaysDetermined precise transcription start sitesCritical for accurate promoter mapping
Point mutation analysisConfirmed functional importance of -10 and -35 regionsReduced promoter activity when these regions were mutated
Western blottingVerified protein expression patternsShowed SpoIIIAH expression despite 5' transposon insertions

These methodological approaches collectively demonstrate that SpoIIIAD functions within a carefully coordinated gene expression program essential for proper sporulation .

What are the critical considerations when designing experiments to study SpoIIIAD function?

When designing experiments to investigate SpoIIIAD function, researchers should implement several key experimental design components to ensure validity:

  • Simultaneous control groups: Include appropriate controls when studying SpoIIIAD. For gene expression studies, this should include strains with intact spoIIIA locus as positive controls and strains with complete deletion of the locus as negative controls .

  • Randomization: When testing multiple conditions or treatments (such as different mutations or expression constructs), randomly assign experimental units to treatment groups to minimize bias .

  • Blinding: Where possible, implement blinding procedures during data collection and analysis to prevent bias, particularly when phenotypic outcomes have subjective elements .

  • Replication: Ensure adequate biological replicates, recognizing that the appropriate experimental unit is the independently treated sample. For sporulation studies, this typically means independent sporulating cultures rather than technical replicates from the same culture .

  • Blocking: Consider implementing randomized complete block designs, particularly if external factors might affect sporulation efficiency (such as batch effects, medium preparation variations, etc.) .

  • Interspersion: Ensure treatments are properly interspersed across experimental runs rather than grouped together, which helps control for temporal variation that might affect results .

How can researchers effectively generate and analyze spoIIIAD mutants?

When generating and analyzing spoIIIAD mutants, researchers should consider:

  • Mutation strategy selection: Options include:

    • Complete gene deletion

    • Point mutations in functional domains

    • Truncation mutations

    • Domain swaps with homologous proteins

  • Construction methodology: Researchers have successfully used approaches documented in the literature:

    • "Double-crossover knockouts were constructed by amplifying each entire gene from chromosomal DNA along with its ribosome binding site and a few bases downstream of the stop codon"

    • Transforming these constructs into competent B. subtilis with selection for chloramphenicol resistance

    • Confirming single crossovers by amplification of the ampicillin resistance gene from chromosomal DNA

  • Complementation analysis: To confirm phenotypes are specifically due to SpoIIIAD disruption:

    • Express SpoIIIAD at ectopic loci (commonly amyE)

    • Use inducible or native-like promoters

    • Test multiple expression levels to account for dosage effects

  • Phenotypic characterization: Systematically evaluate:

    • Sporulation efficiency (quantitative)

    • Spore morphology and integrity

    • Resistance properties of resulting spores

    • Activation of σG-dependent genes

What methodological approaches are best for studying SpoIIIAD promoter activity?

Based on successful studies in the literature, the following approaches are recommended:

  • Transcriptional fusion construction:

    • "Fragments of DNA were cloned into pDG1661, which contains a promoterless lacZ gene"

    • This allows quantitative measurement of promoter activity through β-galactosidase assays

  • Deletion analysis:

    • Create "sequential deletions from the 5′ and 3′ ends of the gene" to precisely map promoter boundaries

    • First establish appropriate 3' end based on β-galactosidase activity

    • Then create successive 100-bp deletions from the 5' end to pinpoint essential promoter elements

  • Point mutation analysis:

    • Introduce specific mutations in predicted -10 and -35 regions

    • Measure effects on promoter activity to confirm the identity of core promoter elements

  • Time-course analysis:

    • Monitor promoter activity throughout sporulation to determine temporal regulation

    • Compare with known sporulation markers to establish relative timing of expression

How does SpoIIIAD contribute to the "feeding tube" model of mother cell-forespore communication?

Recent research suggests that the eight SpoIIIA proteins, including SpoIIIAD, may form a specialized secretion apparatus that maintains forespore integrity during sporulation . Within this model:

  • SpoIIIAD likely occupies a specific position in the assembly of this complex machinery

  • The proper functioning of this apparatus appears essential for forespore integrity, as in its absence "the forespore develops large invaginations and appears to collapse"

  • This suggests SpoIIIAD plays a structural or functional role in maintaining a channel or "feeding tube" between the mother cell and forespore

The precise molecular arrangement and stoichiometry of SpoIIIAD within this complex remain active areas of investigation. Researchers should consider protein-protein interaction studies, structural biology approaches, and advanced microscopy techniques to further elucidate this machinery.

What analytical techniques are most appropriate for studying SpoIIIAD interactions?

For comprehensive investigation of SpoIIIAD interactions, researchers should consider employing multiple complementary techniques:

TechniqueApplication to SpoIIIAD ResearchMethodological Considerations
Bacterial two-hybridScreen for binary protein interactions between SpoIIIAD and other SpoIIIA proteinsMay produce false positives/negatives; requires validation
Co-immunoprecipitationConfirm interactions in native contextRequires specific antibodies or epitope tags
Blue native PAGEAnalyze intact complexes containing SpoIIIADMaintains native protein interactions better than SDS-PAGE
Mass spectrometryIdentify interacting partners and post-translational modificationsRequires careful sample preparation to preserve interactions
Fluorescence microscopyVisualize SpoIIIAD localization during sporulationConsider photobleaching and resolution limitations
Cryo-electron microscopyStructural analysis of SpoIIIAD within larger complexesTechnically challenging but provides high-resolution insights

Researchers should implement appropriate controls and validation strategies for each method, recognizing that a multi-technique approach provides the most robust evidence for protein interactions.

How can researchers address potential biases and validity threats in SpoIIIAD functional studies?

To ensure robust and reproducible results when studying SpoIIIAD, researchers should implement several methodological safeguards:

  • Address pseudoreplication: "Multiple individual organisms belonging to the same unit (e.g., plants in the same plot, bacteria in the same dish) should be considered together as a single replicate" . In sporulation studies, this means treating multiple observations from the same culture as a single replicate.

  • Control for positional effects: When inserting constructs at ectopic loci, control for potential position effects by:

    • Using the same integration site for all constructs

    • Testing multiple integration sites to confirm consistent phenotypes

    • Including appropriate empty vector controls at the same integration sites

  • Validate experimental tools: For transcriptional fusions, researchers should:

    • Verify the stability of fusion constructs

    • Confirm specificity of activity through appropriate negative controls

    • Validate that fusion constructs don't interfere with native gene function

  • Statistical analysis considerations:

    • Use paired designs when possible as they "are usually more powerful than completely randomized design, because it controls for a lot of the extraneous variation between plots or sampling units"

    • For designs with blocking variables, use appropriate statistical models that account for block effects

    • Report effect sizes alongside statistical significance to indicate biological relevance

  • Evaluate methodological choices: "Your methods section should clearly make the case for why you chose the methods you did... discuss why other methods were not suitable for your objectives, and show how this approach contributes new knowledge or understanding"

What are the optimal conditions for expressing and purifying recombinant SpoIIIAD?

When expressing and purifying recombinant SpoIIIAD, researchers should consider:

  • Expression system selection:

    • E. coli-based systems typically provide high yields but may lack sporulation-specific post-translational modifications

    • B. subtilis-based systems offer native-like processing but potentially lower yields

    • Cell-free systems may be useful for proteins that affect host viability

  • Construct design considerations:

    • Include ribosome binding sites optimized for the host system

    • Consider codon optimization for the expression host

    • Evaluate various fusion tags (His6, GST, MBP) for solubility enhancement

    • Include protease cleavage sites for tag removal when necessary

  • Purification strategy:

    • Design a multi-step chromatography approach

    • Begin with affinity chromatography based on fusion tag

    • Follow with ion exchange and/or size exclusion chromatography

    • Verify protein identity by mass spectrometry

    • Confirm biological activity through functional assays

  • Protein quality assessment:

    • Evaluate protein folding through circular dichroism

    • Analyze oligomeric state by size exclusion chromatography

    • Verify functionality through in vitro activity assays when possible

How can researchers effectively investigate SpoIIIAD structure-function relationships?

Structure-function analysis of SpoIIIAD should proceed systematically:

  • Bioinformatic analysis:

    • Align SpoIIIAD with homologs to identify conserved domains

    • Use structural prediction tools to generate initial models

    • Identify potential functional motifs for targeted mutagenesis

  • Mutational analysis approaches:

    • Alanine-scanning mutagenesis of conserved residues

    • Domain swapping with homologous proteins

    • Truncation analysis to identify minimal functional domains

    • Introduction of specific mutations based on predicted structure

  • Functional validation:

    • Test mutant constructs in complementation assays

    • Quantitatively measure sporulation efficiency

    • Evaluate effects on protein-protein interactions

    • Assess impacts on subcellular localization

  • Integration with structural studies:

    • Combine mutational data with available structural information

    • Use mutational data to guide crystallization attempts

    • Validate structural predictions through targeted experiments

What controls are essential when designing experiments with recombinant SpoIIIAD?

Robust experimental design for recombinant SpoIIIAD work requires several critical controls:

  • Expression controls:

    • Empty vector transformants to control for effects of the expression system

    • Inactive mutant versions (e.g., site-directed mutants in predicted active sites)

    • Wild-type protein expressed under identical conditions

  • Purification controls:

    • Mock purifications from cells containing empty vector

    • Monitoring of potential contaminants via SDS-PAGE and mass spectrometry

    • Assessment of batch-to-batch variation

  • Activity assay controls:

    • Heat-denatured protein samples

    • Titration of protein concentration to establish dose-dependence

    • Inclusion of known inhibitors when available

    • Testing of related proteins to establish specificity

  • In vivo complementation controls:

    • Empty vector integrations at the same chromosomal locus

    • Wild-type gene reintroduction to verify full complementation

    • Unrelated proteins expressed from the same promoter/integration site

How should researchers analyze quantitative data from SpoIIIAD experiments?

For rigorous analysis of quantitative data:

  • Data preparation:

    • "Check for missing data, remove outliers, transform variables" as needed

    • Verify normality assumptions for parametric statistical tests

    • Consider appropriate transformations for non-normal data

  • Statistical approach selection:

    • For comparing two conditions: t-tests or non-parametric alternatives

    • For multiple conditions: ANOVA with appropriate post-hoc tests

    • For time-course data: repeated measures designs or mixed models

    • For examining relationships: regression or correlation analyses

  • Software recommendations:

    • Statistical packages: "SPSS, Stata or R"

    • Consider R for reproducible analysis with documented code

    • Specialized packages for specific analyses (e.g., DESeq2 for RNA-seq data)

  • Reporting recommendations:

    • Include both descriptive statistics and inferential tests

    • Report effect sizes alongside p-values

    • Provide clear visualization of data through appropriate graphs

    • Include sample sizes and power calculations where appropriate

How can researchers effectively integrate multiple data types in SpoIIIAD studies?

Modern research on SpoIIIAD often generates diverse data types that must be integrated:

  • Mixed methods approaches:

    • "Mixed methods combine the above two research methods, integrating both qualitative and quantitative approaches into one coherent analytical process"

    • For example, combine quantitative sporulation efficiency measurements with qualitative microscopy observations

  • Data integration strategies:

    • Use common identifiers across datasets

    • Develop consistent metadata standards

    • Consider dimension reduction techniques for high-dimensional data

    • Use visualization approaches that highlight relationships between data types

  • Triangulation approaches:

    • Look for convergent evidence across multiple experimental approaches

    • Address discrepancies through additional targeted experiments

    • Weight evidence based on methodological strengths of each approach

  • Computational integration:

    • Consider pathway or network analysis to place SpoIIIAD in broader context

    • Use machine learning approaches for complex pattern recognition

    • Develop predictive models that integrate multiple data sources

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.