Recombinant Bacillus subtilis Stage III sporulation protein AG (spoIIIAG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
spoIIIAG; BSU24370; Stage III sporulation protein AG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
spoIIIAG
Target Protein Sequence
MNKNGLWNVLKKQFLPGQTKDGEKPKLTKYHYFLFVFVLGVSFMLVSQLFSSPEKTENAK TITAVSSQHSADSKEKTAEVFKASKSDKPKDSIDDYEKEYENQLKEILETIIGVDDVSVV VNVDATSLKVYEKNKSNKNTTTEETDKEGGKRSVTDQSSEEEIVMIKNGDKETPVVVQTK KPDIRGVLVVAQGVDNVQIKQTIIEAVTRVLDVPSHRVAVAPKKIKEDS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is SpoIIIAG and what role does it play in bacterial sporulation?

SpoIIIAG is a critical component of the "feeding tube apparatus" formed during Bacillus subtilis sporulation. This protein assembles into a large, 30-fold symmetric complex with a unique mushroom-like architecture that creates a direct conduit between the mother cell and forespore during the engulfment process. The complex is essential for maintaining forespore development by facilitating the transport of materials between the two cells .

The SpoIIIAG complex is composed of three distinctive circular structures:

  • A 60-stranded vertical β-barrel forming a large inner channel

  • A planar β-ring

  • An external ring formed by repeats of a ring-building motif (RBM)

This complex architecture allows SpoIIIAG to function as part of a specialized secretion system that spans the double membrane separating the mother cell and developing forespore.

How does the structure of SpoIIIAG compare to components of other bacterial secretion systems?

Secretion System ComponentOrganismStructural Similarity to SpoIIIAG
EscJ, PrgK (T3SS)EPEC, SalmonellaRBM domain (<20% sequence identity, ~2Å Cα backbone RMSD)
FliF (Flagellar)Various bacteriaFlagellar-specific predicted RBM with β-sheet-rich insertion
SpoIIIAHB. subtilisRBM domain without the β-triangle insertion

This structural comparison highlights how SpoIIIAG represents an evolutionary adaptation of a common bacterial protein motif to serve the specialized needs of the sporulation process .

What are the key domains in SpoIIIAG and how do they contribute to its function?

The monomeric structure of SpoIIIAG55-end comprises:

  • A long disordered region (residues 55-88)

  • The ring-building motif (RBM) (residues 89-125 and 181-227) with α1β1β8α2β9 topology

  • The unique β-triangle motif (residues 126-178) inserted within the β1β8 hairpin of the RBM

The β-triangle motif presents a unique fold of six antiparallel β-sheets arranged as a planar three-pointed star, not found in any other known protein structure. This motif creates the distinctive channel that characterizes the SpoIIIAG complex. The RBM domain facilitates oligomerization through extensive interfaces (890 Ų), while the disordered N-terminal region likely provides flexibility for interactions with other components of the sporulation machinery .

What are the recommended methods for recombinant expression and purification of SpoIIIAG?

For successful recombinant expression and purification of SpoIIIAG, the following protocol has been effective:

  • Gene amplification and cloning:

    • Amplify the truncated spoIIIAG gene (UniProt P49784-1; residues 55-229 or 83-229) via PCR from B. subtilis strain PY79 genomic DNA

    • Design primers to introduce NdeI site at initiation codon and BamHI site after termination codon

    • Digest the DNA fragments with NdeI and BamHI and clone into pET28a(+) vector

  • Expression:

    • Culture B. subtilis strains in LB medium to mid-log growth phase (OD600 reaching 0.8-1.0)

    • Collect aliquots equivalent to an OD600 of 2.4 for analysis

  • Purification:

    • Express with an N-terminal 6-His tag followed by a thrombin cleavage site

    • Lyse cells using appropriate buffer containing lysozyme

    • Purify using affinity chromatography

    • Verify purity using SDS-PAGE analysis

This approach yields soluble SpoIIIAG that can self-assemble into the characteristic ring structure observed by electron microscopy.

What structural analysis techniques are most effective for studying SpoIIIAG assemblies?

Several complementary techniques have proven effective for studying the complex structure of SpoIIIAG:

  • Cryo-electron microscopy (cryo-EM): The near-atomic resolution structure of SpoIIIAG was determined at ~3.5Å using single-particle cryo-EM. This technique revealed the unique mushroom-like architecture and allowed de novo manual tracing of backbone atoms and unambiguous assignment of side chains .

  • Transmission electron microscopy (TEM): Initial observations of the purified SpoIIIAG extracellular domain self-assembling into a consistently sized circular complex (~600 kDa) were made using TEM .

  • X-ray crystallography: While not yet successful for the full SpoIIIAG complex, this technique has been applied to other sporulation proteins like SpoIIIAB and could provide complementary structural information .

  • Computational modeling: Rosetta-based atomic model optimization has been used to resolve side chain densities in regions not clearly defined by cryo-EM data .

The integration of these techniques allows researchers to overcome the limitations of any single approach and build a comprehensive understanding of SpoIIIAG structure at multiple levels of organization.

How can researchers verify the functional importance of specific SpoIIIAG residues?

To validate the functional significance of specific SpoIIIAG residues or domains, researchers can employ the following approaches:

  • Structure-guided mutagenesis:

    • Target residues located at key interfaces between monomers

    • Create point mutations that disrupt specific interactions

    • Express mutant proteins both in vitro and in vivo

  • In vitro assembly assays:

    • Analyze the ability of mutant SpoIIIAG to form ring structures using TEM or cryo-EM

    • Compare assembly kinetics and stability of wild-type and mutant proteins

  • In vivo functional assays:

    • Monitor sporulation efficiency in B. subtilis strains expressing mutant SpoIIIAG

    • Evaluate spore viability and resistance to environmental stressors

  • Protein-protein interaction studies:

    • Identify changes in interactions with other sporulation proteins using co-immunoprecipitation or two-hybrid assays

    • Map interaction surfaces through crosslinking studies

These complementary approaches provide strong evidence for the structural and functional importance of specific residues within the SpoIIIAG protein.

How does the SpoIIIAG complex integrate with other components of the sporulation machinery?

The SpoIIIAG complex appears to serve as a central element in a larger transenvelope assembly connecting the mother cell and forespore. Current models suggest:

  • Mother cell membrane interface:

    • The mushroom-like cap of the SpoIIIAG complex likely faces the mother cell membrane

    • The steep 37-degree height decline and relatively inaccessible 13-Å depth of the electropositive ring-shaped groove suggest an indirect interaction with the membrane

    • SpoIIIAF, which contains a tandem pair of N-terminal bitopic transmembrane helices followed by an RBM, may fill this gap and provide charge/shape complementation

  • Forespore interface:

    • The SpoIIIAG complex likely interacts with the SpoIIIAH-SpoIIQ ring complex

    • Correlations between the 15-fold SpoIIIAH-SpoIIQ ring model and the 30-fold SpoIIIAG complex symmetries, along with similar dimensions and charge compatibility, suggest a potential interaction interface

Complex ComponentLocationSymmetryOuter/Inner Diameter
SpoIIIAGMother cell side30-fold210 Å/74 Å
SpoIIIAH-SpoIIQInterface between cells15-fold193 Å/82 Å
SpoIIIAFMother cell membraneUnknownPredicted to complement SpoIIIAG

The complete transenvelope complex likely includes at least nine proteins (SpoIIQ from the forespore and SpoIIIAA-AH from the mother cell), forming a hybrid secretion system with structural elements borrowed from various bacterial secretion systems .

What are the current hypotheses regarding substrate transport through the SpoIIIAG channel?

Several hypotheses exist regarding what substrates might be transported through the SpoIIIAG channel and how this transport is regulated:

  • Macromolecular transport:

    • The dimensions of the SpoIIIAG inner channel (74 Å inner diameter) suggest it could facilitate the passage of large macromolecules between the mother cell and forespore

    • This may include proteins, nutrients, or signaling molecules essential for forespore development

  • Energy coupling:

    • SpoIIIAA, which relates to AAA+ superfamily ATPases involved in T2S and T4S, may provide energy for substrate transport

    • This suggests an active transport mechanism rather than passive diffusion

  • Directional transport:

    • The orientation of the complex (cap facing mother cell, stem facing forespore) suggests directionality in the transport process

    • This may allow the mother cell to control what materials enter the developing forespore

  • Regulatory mechanisms:

    • Given the similarity to secretion systems, transport may be regulated by conformational changes in the complex

    • These changes could be triggered by interactions with other proteins or by post-translational modifications

Research using fluorescent tracers or tagged potential substrates could help clarify which of these hypotheses most accurately describes SpoIIIAG function.

How can structural insights into SpoIIIAG inform novel experimental approaches to sporulation research?

The high-resolution structural characterization of SpoIIIAG opens several new avenues for sporulation research:

  • Structure-based drug design:

    • The detailed structure of SpoIIIAG could inform the development of small molecules that specifically inhibit or modulate sporulation

    • Such compounds could be valuable research tools and potential antimicrobials against spore-forming pathogens

  • Bioengineering applications:

    • Understanding the structural basis of SpoIIIAG assembly could inform the design of synthetic protein channels with custom properties

    • These engineered channels could have applications in synthetic biology or drug delivery systems

  • Evolutionary insights:

    • Comparative structural analysis of SpoIIIAG across different Bacillus species could reveal how this channel has evolved

    • This may provide insights into species-specific adaptations in sporulation

  • In situ visualization:

    • The structural model enables the design of specific antibodies or nanobodies against conformational epitopes

    • These tools could facilitate super-resolution microscopy studies of the intact sporulation machinery in cells

These approaches demonstrate how structural biology can directly inform functional studies and technological applications related to bacterial sporulation.

What experimental design approaches are most effective for studying SpoIIIAG function in vivo?

When investigating SpoIIIAG function in the context of live cells, consider the following experimental design approaches:

  • Genetic manipulation strategies:

    • Create precise point mutations rather than complete gene deletions to maintain protein expression levels

    • Use complementation studies with wild-type and mutant versions to verify phenotypes

    • Consider conditional expression systems to study the temporal requirements for SpoIIIAG

  • Sporulation efficiency assays:

    • Measure sporulation frequency using standardized conditions

    • Compare heat resistance of wild-type versus mutant spores

    • Analyze germination kinetics to evaluate spore quality

  • Live-cell microscopy:

    • Use fluorescently tagged SpoIIIAG to monitor localization during sporulation

    • Implement time-lapse imaging to track dynamic assembly processes

    • Combine with other tagged components to visualize complex formation

  • Gene expression analysis:

    • Monitor forespore-specific gene expression as a readout of feeding tube function

    • Use reporter systems (e.g., β-galactosidase assays or fluorescent proteins) under forespore-specific promoters

    • Compare expression patterns in wild-type and mutant backgrounds

These approaches should be implemented with appropriate controls and statistical validation to ensure reproducibility and meaningful interpretation of results.

How can researchers resolve contradictory findings in SpoIIIAG structural studies?

Contradictory findings regarding SpoIIIAG structure or function can arise from various sources. A systematic approach to resolving such discrepancies includes:

  • Method triangulation:

    • Apply multiple, complementary structural techniques (cryo-EM, X-ray crystallography, NMR)

    • Compare results obtained under different experimental conditions

    • Validate structural models using biochemical and functional assays

  • Careful protein preparation:

    • Standardize expression and purification protocols

    • Verify protein integrity and homogeneity before structural analysis

    • Consider the impact of tags, fusion partners, or truncations on structure

  • Physiological relevance:

    • Compare in vitro assemblies with structures observed in situ

    • Consider the influence of other proteins or cellular factors on structure

    • Verify that observed structures are compatible with known functional data

  • Computational validation:

    • Use molecular dynamics simulations to test the stability of proposed structures

    • Apply energy minimization and validation tools to evaluate model quality

    • Consider alternative interpretations of experimental data

A systematic comparison table documenting differences in experimental approaches can help identify the source of discrepancies:

StudyProtein ConstructExpression SystemPurification MethodStructural TechniqueResolutionKey Findings
Study AFull-lengthE. coliAffinity + SECCryo-EM3.5Å30-fold symmetry
Study BTruncatedB. subtilisIon exchangeX-ray crystallography2.8ÅDifferent oligomeric state

This approach facilitates transparent comparison and can reveal the experimental variables that may account for different outcomes.

What research questions should be prioritized in future studies of SpoIIIAG?

Based on current knowledge and gaps identified in the literature, several key research questions merit prioritization:

  • Complete structural characterization:

    • How does the full transenvelope complex assemble, including all nine required proteins?

    • What is the structure of SpoIIIAG in complex with its interaction partners (SpoIIIAF, SpoIIIAH, etc.)?

    • How does the complex change conformation during different stages of sporulation?

  • Transport mechanism:

    • What specific molecules are transported through the SpoIIIAG channel?

    • How is transport regulated (gated or constitutive)?

    • What provides the energy for transport?

  • Assembly and regulation:

    • What triggers SpoIIIAG assembly during sporulation?

    • How is complex formation coordinated with other sporulation events?

    • Are there post-translational modifications that affect SpoIIIAG function?

  • Evolutionary aspects:

    • How conserved is SpoIIIAG structure and function across different Bacillus species?

    • How did this specialized channel evolve from components of different secretion systems?

    • Could similar structures exist in other bacterial processes?

  • Applied aspects:

    • Can the SpoIIIAG channel be targeted to inhibit sporulation in pathogenic species?

    • Could engineered versions of the complex have biotechnological applications?

    • Does the complex have potential as a drug delivery system in spore-based probiotics?

Addressing these questions will require interdisciplinary approaches combining structural biology, genetics, biochemistry, and computational modeling.

What are the common challenges in expressing and purifying recombinant SpoIIIAG?

Researchers working with recombinant SpoIIIAG may encounter several technical challenges:

  • Solubility issues:

    • The complete SpoIIIAG protein contains a transmembrane domain that can cause aggregation

    • Using truncated constructs (residues 55-229 or 83-229) that exclude the transmembrane region improves solubility

  • Oligomeric heterogeneity:

    • SpoIIIAG can form different oligomeric states depending on buffer conditions

    • Standardizing buffer composition, protein concentration, and incubation time is crucial for reproducible results

  • Protein stability:

    • The complex architecture of SpoIIIAG makes it sensitive to degradation

    • Including protease inhibitors throughout purification and storing at appropriate temperatures is essential

  • Expression optimization:

    • Expression levels may vary between different host systems

    • Optimizing induction conditions (temperature, IPTG concentration, duration) can improve yield

  • Functional verification:

    • Confirming that recombinant SpoIIIAG maintains its native oligomerization and function

    • Developing reliable assays to verify assembly into the characteristic 30-mer complex

Addressing these challenges requires systematic optimization of expression and purification protocols, potentially including the exploration of different expression systems, fusion tags, and buffer conditions.

How can researchers design effective mutagenesis studies to probe SpoIIIAG function?

Effective mutagenesis studies of SpoIIIAG should follow these principles:

  • Structure-guided approach:

    • Target residues based on the high-resolution structural data

    • Focus on:

      • Interface residues between monomers

      • Conserved residues in the RBM

      • Residues in the β-triangle motif that form the channel

      • Potential interaction surfaces with other proteins

  • Mutation types:

    • Conservative mutations to test specific chemical properties

    • Charge reversals to disrupt electrostatic interactions

    • Alanine scanning of interface regions

    • Insertion or deletion mutations to test structural elements

  • Validation strategy:

    • Test effects on oligomerization in vitro

    • Assess impact on sporulation efficiency in vivo

    • Examine interactions with partner proteins

    • Monitor subcellular localization

  • Controls and standards:

    • Include wild-type protein as a positive control

    • Use known non-functional mutations as negative controls

    • Create a series of mutations with graduated severity to establish structure-function relationships

This systematic approach will generate a comprehensive understanding of the relationship between SpoIIIAG structure and function.

What new technologies might advance our understanding of SpoIIIAG in the coming years?

Several emerging technologies hold promise for advancing SpoIIIAG research:

  • Cryo-electron tomography:

    • Visualize the complete feeding tube apparatus in situ

    • Reveal the native arrangement of all components within the cellular context

    • Provide insights into dynamic changes during sporulation

  • Single-molecule techniques:

    • Measure transport through individual SpoIIIAG channels

    • Track assembly dynamics in real-time

    • Detect conformational changes during function

  • Mass spectrometry advancements:

    • Identify post-translational modifications of SpoIIIAG

    • Determine stoichiometry of the complete complex

    • Map protein-protein interactions with high precision

  • CRISPR-based approaches:

    • Create precise genomic modifications to study SpoIIIAG function

    • Implement conditional degradation systems for temporal control

    • Develop high-throughput screening methods for functional variants

  • Computational advances:

    • Improved molecular dynamics simulations of large protein complexes

    • Better prediction of protein-protein interactions

    • Integration of structural data with systems biology approaches

These technological advances will provide unprecedented insights into how SpoIIIAG functions within the complex environment of the sporulating cell.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.