Recombinant Bacillus subtilis Stage V sporulation protein AF (spoVAF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bacillus subtilis Stage V Sporulation Protein AF (spoVAF)

Recombinant Bacillus subtilis Stage V sporulation protein AF (spoVAF), encoded by the spoVAF gene (UniProt ID: P31845), is a critical component of the spoVA operon involved in spore formation and germination. This protein is primarily expressed during sporulation in the mother cell and is localized to the inner membrane of developing spores . The recombinant form is typically produced in E. coli with an N-terminal His tag for purification and is available in lyophilized or liquid formats .

Functional Roles in Spore Formation and Germination

spoVAF is part of the spoVA operon, which encodes proteins essential for dipicolinic acid (DPA) uptake and release during spore formation and germination . Key findings include:

Germination Phenotypes in Mutant Strains

GenotypeGermination Speed (GR-Dependent)Germination Speed (Non-GR)DPA Levels
Wild-typeNormalNormalNormal
ΔspoVAFSlowerNormalNormal
ΔspoVAEa + ΔspoVAFSlowerNormalNormal

Deletion of spoVAF alone or in combination with spoVAEa did not impair sporulation or DPA accumulation but reduced germination speed with GR-dependent germinants (e.g., L-alanine) . This defect was rescued by ectopic expression of SpoVAF .

Experimental Uses

  • SDS-PAGE Analysis: Recombinant spoVAF is validated for electrophoresis to confirm purity and size .

  • Germination Studies: Used to investigate the role of SpoVAF in GR-mediated signaling and DPA release kinetics .

  • Structural Studies: Full-length His-tagged spoVAF facilitates crystallization or NMR studies to probe membrane interactions .

Key Research Findings

  1. DPA-Independent Function: SpoVAF is dispensable for DPA uptake but critical for efficient germination with nutrient receptors .

  2. Evolutionary Conservation: The spoVAF gene is absent in some Bacillales species, suggesting functional redundancy in certain lineages .

  3. Proteinase K Sensitivity: SpoVAF is accessible to external proteases in germinated spores, aligning with its surface localization on the inner membrane .

Challenges and Future Directions

  • Functional Redundancy: While SpoVAF deletion slows germination, other SpoVA proteins (e.g., SpoVAD) may compensate for its absence, limiting its essentiality .

  • Custom Production Needs: Partial-length constructs (e.g., SPOVAF-1245B) require prolonged lead times (5–9 weeks) for optimization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate your specific requirements. Please indicate your preferred format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery time.
Note: Our standard shipping method includes blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
spoVAF; BSU23390; Stage V sporulation protein AF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-493
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
spoVAF
Target Protein Sequence
MPDHKEEKIRVYRNPAKNEEYFKNRVGMGTSYDVGVRKLTILDKEIQLYYLNGLCDTAYI IHLMRELVAINNRKEDPDELVDIVENRLLNAQVEKVKTLDETTDQVLSGLVAVIVEGAGF AFIIDVRSYPGRNPEEPDTEKVVRGARDGFVENIVVNTALLRRRIRDERLRVKMTKVGER SKTDLSICYIEDIADPDLVEIVEKEIASIDVDGLTMADKTVEEFIVNQSYNPFPLVRYTE RPDVAANHVLEGHVIIIVDTSPSVIITPTTLFHHVQHAEEYRQAPSVGTFLRWVRFFGIL ASTLFLPIWFLFVLQPDLLPDNMKFIGLNKDTHIPIILQIFLADLGIEFLRMAAIHTPTA LSTAMGLIAAVLIGQIAIEVGLFSPEVILYVSLAAIGTFTTPSYELSLANKMSRLVLMIL VALFHIKGLVIGFTVLIIAMASIKSLQTPYLWPLIPFNGKALWQVLVRTAKPGAKVRPSI VHPKNRLRQPTNS
Uniprot No.

Target Background

Database Links

KEGG: bsu:BSU23390

Protein Families
GerABKA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SpoVAF and what is its role in Bacillus subtilis?

SpoVAF (Stage V sporulation protein AF) is a protein encoded by the spoVAF gene within the spoVA operon of Bacillus subtilis. The spoVA operon contains seven genes (spoVAA, -B, -C, -D, -Eb, -Ea, and -F) that are expressed specifically during the sporulation process . SpoVAF is likely an integral inner spore membrane protein that exhibits sequence identity to A subunits of the spore's nutrient germinant receptors (GRs) . Recent research has identified that SpoVAF functions as part of a complex with FigP (YqhR), forming an ion channel that plays a critical role in spore germination by amplifying the response of germinant receptors to nutrients .

While B. subtilis strains lacking SpoVAF can sporulate normally and produce spores with normal dipicolinic acid (DPA) levels, these spores exhibit slower germination specifically with GR-dependent germinants . This indicates that SpoVAF is not essential for spore formation but contributes significantly to the efficiency of the germination process, particularly in response to nutrient signals.

How does the SpoVAF/FigP complex function in spore germination?

The SpoVAF/FigP complex functions as an ion channel during bacterial spore germination. Recent research has revealed that this complex plays a crucial role in amplifying the response of germinant receptors (GRs) to nutrient germinants . The mechanism involves:

  • Signal amplification: The complex enhances germination by facilitating the release of ions, particularly potassium (K+), which amplifies the response of germination receptors to germinants .

  • GR-dependent activation: Importantly, the SpoVAF/FigP complex appears to require activation by GerA-type GRs to function. Despite being predicted to function as an ion channel, research shows that the complex fails to be activated by moderate high pressure (MHP) in the absence of GerA-type GRs .

  • Interdependence of components: SpoVAF and FigP are interdependent for stability, suggesting that they form a functional complex that requires both components to be properly assembled .

This complex represents a key component in the signal transduction pathway of spore germination, serving as an amplifier that enhances the initial germination signals received through nutrient receptors.

What is the relationship between SpoVAF and dipicolinic acid (DPA) in spores?

While SpoVAF is part of the spoVA operon, which encodes proteins essential for DPA uptake and release during sporulation and germination, SpoVAF itself appears to have a less direct role in DPA handling compared to other SpoVA proteins . Research has shown that:

  • B. subtilis strains lacking SpoVAF sporulate normally and their spores contain normal levels of DPA, unlike strains lacking other SpoVA proteins (such as SpoVAA, -B, -C, -D, and -Eb) which are essential for DPA uptake during sporulation .

  • Other SpoVA proteins like SpoVAD have been shown to bind DPA specifically, with this binding being essential for DPA uptake during sporulation .

  • SpoVAF appears to be more involved in the germination process, particularly in enhancing the efficiency of germination with GR-dependent germinants, rather than directly managing DPA content .

This suggests that while SpoVAF is expressed alongside proteins crucial for DPA management, its primary function may be more related to signal transduction during germination rather than direct DPA transport.

How does the SpoVAF/FigP complex contribute to high-pressure-induced germination?

Recent research has revealed that the SpoVAF/FigP complex plays an important role in high-pressure-induced germination of Bacillus subtilis spores. Key findings include:

These findings provide valuable insights into optimizing high-pressure processing for spore control in various applications, including food preservation technologies.

What experimental approaches are most effective for studying SpoVAF function under high pressure?

Based on recent research methodologies, the following experimental approaches have proven effective for studying SpoVAF function under high pressure:

  • Genetic modification approaches:

    • Construction of deletion mutants (Δ5AF, ΔfigP, and Δ5AF ΔfigP) to evaluate the specific contributions of SpoVAF and FigP

    • Complementation studies with ectopic expression to confirm phenotype specificity

  • Quantitative assessment methods:

    • Monitoring DPA release as a marker of germination progress under different pressure conditions

    • Use of modeling and fitting techniques to quantitatively examine factors influencing the complex's function

  • Environmental parameter control:

    • Systematic variation of pressure levels (50-300 MPa) to determine pressure-response relationships

    • Temperature control during pressure treatment (22°C-37°C) to assess temperature effects

    • Manipulation of sporulation conditions to evaluate developmental influences

  • Ion flux measurements:

    • Assessing potassium (K+) release patterns to evaluate ion channel function

  • Protein interaction studies:

    • Protein-protein interaction predictions using databases like STRING

    • Confirmation of interactions through experimental methods

These approaches can be combined to provide comprehensive insights into SpoVAF function under various pressure conditions, offering both mechanistic understanding and practical applications for spore control technologies.

What are the optimal conditions for storing and handling recombinant SpoVAF protein?

For researchers working with recombinant SpoVAF protein, the following storage and handling guidelines should be followed to maintain protein stability and functionality:

  • Storage recommendations:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

  • Buffer conditions:

    • The protein is typically supplied in a Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

    • The default final concentration of glycerol is typically 50%

  • Critical precautions:

    • Repeated freezing and thawing is not recommended as it may affect protein stability and function

    • For membrane proteins like SpoVAF, maintaining proper folding and structure is particularly important for functional studies

These guidelines will help ensure that recombinant SpoVAF protein maintains its structural integrity and functional properties during storage and experimental use.

What methods are most effective for studying SpoVAF localization in bacterial spores?

Based on approaches used with other SpoVA proteins, the following methods are most effective for studying SpoVAF localization in bacterial spores:

  • Biotinylation accessibility assays:

    • External biotinylation agents can be used to determine surface accessibility of proteins in spores

    • Similar approaches have been successful in demonstrating that SpoVAEa is present on the outer surface of the spore's inner membrane

  • Proteinase K treatment:

    • Treating germinated spores with proteinase K and monitoring protein disappearance rates

    • This approach has shown that SpoVAEa disappears in parallel with SpoVAD during proteinase K treatment of germinated spores

  • Fractionation studies:

    • Distributional analysis in fractions of disrupted dormant spores

    • This technique has been used to show that SpoVAEa and SpoVAD are distributed similarly in spore fractions

  • Fluorescent protein fusions:

    • Creating GFP or other fluorescent protein fusions to visualize protein localization

    • This approach can be particularly useful for studying membrane proteins like SpoVAF

  • Immunoelectron microscopy:

    • Using gold-labeled antibodies against SpoVAF to precisely localize the protein within the spore structure

These methodologies, particularly when used in combination, can provide comprehensive insights into SpoVAF localization and potential redistribution during sporulation and germination processes.

How do mutations in SpoVAF affect spore germination under different conditions?

Studies investigating the effects of SpoVAF mutations on spore germination have revealed several important findings:

These findings highlight the complex role of SpoVAF in spore germination and suggest that targeted mutations could be used to modulate germination responses for various applications.

What are the predicted protein-protein interactions of SpoVAF with other spore components?

Protein-protein interaction predictions and experimental evidence suggest several important interactions between SpoVAF and other spore components:

  • FigP (YqhR) interaction:

    • SpoVAF forms a functional complex with FigP

    • These proteins are interdependent for stability, suggesting a direct physical interaction

    • The complex functions as an ion channel during germination

  • Other SpoVA proteins:

    • Protein-protein interaction predictions using the STRING database suggest that SpoVAF might interact with other SpoVA subunits

    • Particularly strong predicted interactions exist with the channel-forming subunits SpoVAC, SpoVAD, and SpoVAEb

    • The exact subcellular localization of the SpoVAF/FigP complex in relation to other SpoVA channel subunits requires experimental confirmation

  • Germinant receptors:

    • Functional evidence suggests interaction between the SpoVAF/FigP complex and GerA-type germinant receptors

    • The complex appears to require activation by GerA-type GRs, suggesting either direct or indirect coupling in a signaling pathway

  • Sequence-based predictions:

    • SpoVAF exhibits sequence identity to A subunits of the spore's nutrient germinant receptors (GRs), suggesting potential structural or functional similarities

These predicted and observed interactions provide a framework for understanding how SpoVAF functions within the broader context of spore germination machinery, though many of these interactions still require direct experimental validation.

What are the most promising approaches for elucidating the complete mechanism of SpoVAF/FigP complex function?

Based on current knowledge gaps identified in the literature, several promising research approaches could help elucidate the complete mechanism of SpoVAF/FigP complex function:

  • Structural biology approaches:

    • High-resolution structural studies (X-ray crystallography, cryo-EM) of the SpoVAF/FigP complex

    • Structural comparisons with other ion channels and germinant receptor components

    • Identification of ion-binding sites and pore-forming regions

  • Advanced electrophysiology:

    • Patch-clamp studies of reconstituted SpoVAF/FigP complexes to directly measure ion channel properties

    • Ion selectivity determination to understand which specific ions are transported

  • Real-time activation monitoring:

    • Development of fluorescent sensors to monitor SpoVAF/FigP complex activation in real-time during germination

    • Correlation of channel opening with specific stages of the germination process

  • Protein-protein interaction mapping:

    • Comprehensive mapping of the SpoVAF interactome using techniques like BioID or proximity labeling

    • Verification of interactions with both germinant receptors and other SpoVA proteins

  • Site-directed mutagenesis:

    • Systematic mutation of predicted functional residues to identify critical regions for channel function

    • Investigation of mutations that modulate pressure and temperature sensitivity

  • Single-molecule tracking:

    • Visualizing the dynamics of individual SpoVAF/FigP complexes during germination

    • Determining if complex components redistribute during the germination process

These approaches would significantly advance our understanding of how the SpoVAF/FigP complex functions as an ion channel and amplifies germination signals in response to various triggers.

How might understanding SpoVAF function contribute to applications in food safety and medical fields?

Understanding SpoVAF function has several potential applications in both food safety and medical fields:

  • Enhanced food preservation strategies:

    • Optimization of high-pressure processing parameters based on SpoVAF/FigP complex functionality under different pressure and temperature conditions

    • Development of more efficient germination-inactivation strategies for food preservation

    • The complex's role in boosting germination efficiency under moderate high pressure (MHP) offers valuable insights for refining food industry practices

  • Novel antimicrobial approaches:

    • Design of compounds that target SpoVAF/FigP complex to either inhibit or enhance spore germination

    • Development of strategies to trigger germination of dormant bacterial spores, making them susceptible to conventional antimicrobials

  • Vaccine development:

    • Utilization of modified spores with altered SpoVAF function as potential vaccine delivery vehicles

    • Modulation of spore properties for improved stability and controlled germination in vaccine applications

  • Biosensors and diagnostics:

    • Development of biosensors based on SpoVAF/FigP complex function to detect environmental conditions or specific compounds

    • Application in rapid detection systems for bacterial spores in clinical or food samples

  • Fundamental scientific knowledge:

    • Enhanced understanding of bacterial signal transduction mechanisms

    • Insights into protein complex assembly and function in specialized membrane environments

These potential applications highlight how basic research on SpoVAF can translate into practical solutions for important challenges in food safety, medical treatment, and biodetection technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.