Recombinant Bacillus subtilis subsp. spizizenii Quinol oxidase subunit 4 (qoxD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
qoxD; BSUW23_18860; Quinol oxidase subunit 4; Quinol oxidase aa3-600, subunit qoxD; Quinol oxidase polypeptide IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-124
Protein Length
Full Length of Mature Protein
Species
Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)
Target Names
qoxD
Target Protein Sequence
ANKSAEHSHFPWKHIVGFALSIVLTLLALWVAVYTDLSSSAKLWIIFGFAFIQAALQLLM FMHMTESENGGIQVGNTLFGFFGAIVIVLGSIWIFAAHYHHGDHMDGNPPGGAEHSEHSG HNE
Uniprot No.

Target Background

Function

This recombinant Bacillus subtilis subsp. spizizenii Quinol oxidase subunit 4 (qoxD) catalyzes quinol oxidation coupled with the reduction of oxygen to water. It is a crucial component in energy conversion during vegetative growth.

Database Links
Protein Families
Cytochrome c oxidase bacterial subunit 4 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Quinol oxidase subunit 4 (qoxD) in Bacillus subtilis?

Quinol oxidase subunit 4 (qoxD) is one of four proteins encoded by the qox operon (qoxA, qoxB, qoxC, and qoxD) that together form the aa3-600 terminal oxidase complex in B. subtilis. This oxidase catalyzes quinol oxidation with the concomitant reduction of O2 to H2O, playing a critical role in the respiratory electron transport chain. The qoxD subunit specifically contributes to the structural integrity and functional activity of the complete oxidase complex. Studies have confirmed that this aa3-600 quinol oxidase is predominant during vegetative growth, and its absence leads to significant alterations in the phenotype of B. subtilis .

How is the qox operon organized in the Bacillus subtilis genome?

The qox genes (qoxA, qoxB, qoxC, and qoxD) are organized in a single operon in the B. subtilis genome. This genetic organization allows for coordinated expression of all four subunits of the quinol oxidase complex. The operon structure ensures stoichiometric production of the subunits, which is essential for proper assembly of the functional oxidase complex. This organization is conserved across different Bacillus species, highlighting its evolutionary significance .

What distinguishes the aa3-600 quinol oxidase from other terminal oxidases in B. subtilis?

B. subtilis contains multiple terminal oxidases, with two prominent aa3-type oxidases: caa3-605 and aa3-600. The caa3-605 oxidase catalyzes cytochrome c oxidation, while the aa3-600 quinol oxidase (containing qoxD) catalyzes quinol oxidation. Both result in the reduction of O2 to H2O, but they differ in their electron donors and structural components. Sequence analysis has revealed that the Qox subunits are structurally related to the large family of mitochondrial-type aa3 terminal oxidases, with amino acid sequences similar to those of Escherichia coli bo quinol oxidase and B. subtilis caa3-605 cytochrome c oxidase .

What experimental approaches can be used to study the phenotypic effects of qoxD mutations in B. subtilis subsp. spizizenii?

The phenotypic effects of qoxD mutations can be studied through a combination of genetic, biochemical, and physiological approaches:

  • Gene knockout methodology: Using the Cre/lox system as described in recent studies for B. subtilis genome modifications. This approach involves:

    • Amplification of upstream (800 bp) and downstream (800 bp) sequences flanking qoxD

    • Fusion with a lox71-zeo-lox66 cassette using PCR

    • Transformation into B. subtilis subsp. spizizenii

    • Selection of transformants resistant to zeocin

    • Removal of the resistance marker using Cre recombinase

  • Comparative growth analysis: Monitor growth parameters (lag phase duration, doubling time, final biomass) between wild-type and qoxD mutant strains under various conditions (different oxygen concentrations, carbon sources, stress conditions).

  • Respiratory measurements: Quantify oxygen consumption rates using oxygen electrodes to assess the impact of qoxD mutation on respiratory capacity.

  • Metabolomic analysis: Compare metabolite profiles between wild-type and mutant strains to identify metabolic pathway alterations resulting from qoxD deficiency.

Previous studies have shown that absence of Qox protein leads to important alterations in B. subtilis phenotype, suggesting that similar effects would be observed in the spizizenii subspecies .

How does the expression of the qox operon change under different growth conditions in B. subtilis subsp. spizizenii?

The expression of the qox operon in B. subtilis is growth phase-dependent and responsive to environmental conditions. While specific data for subsp. spizizenii is limited, a methodological approach to address this question would include:

  • qRT-PCR analysis: Quantify qoxD transcript levels under various growth conditions (aerobic vs. microaerobic, different carbon sources, exponential vs. stationary phase).

  • Promoter-reporter fusion studies: Construct fusions of the qox operon promoter with reporter genes (lacZ, gfp) to visualize expression patterns.

  • Chromatin immunoprecipitation (ChIP): Identify transcription factors binding to the qox promoter under different conditions.

  • RNA-seq analysis: Compare whole-transcriptome profiles to identify co-regulated genes and regulatory networks.

Research has shown that the Qox oxidase is predominant during vegetative growth, suggesting that expression is highest during exponential phase and may be regulated by growth phase-dependent factors .

What structural features of qoxD contribute to the assembly and function of the quinol oxidase complex?

While the search results don't provide specific structural information about qoxD, a research approach to address this question would include:

  • Homology modeling: Using the amino acid sequence of B. subtilis subsp. spizizenii qoxD to create structural models based on homologous proteins with known structures.

  • Site-directed mutagenesis: Systematically alter conserved residues to identify those critical for assembly or function.

  • Protein-protein interaction studies: Employ techniques such as bacterial two-hybrid assays or co-immunoprecipitation to map interactions between qoxD and other Qox subunits.

  • Cysteine scanning mutagenesis: Introduce cysteine residues at various positions to probe the membrane topology and accessibility of different regions of qoxD.

The amino acid sequences of Qox subunits share similarities with E. coli bo quinol oxidase and B. subtilis caa3-605 cytochrome c oxidase, suggesting structural conservation among terminal oxidases .

What is the optimal protocol for cloning and expressing recombinant qoxD from B. subtilis subsp. spizizenii?

Based on successful approaches used for other B. subtilis genes, the following protocol is recommended:

Table 1: PCR Conditions for qoxD Amplification

ComponentVolume (μL)Final Concentration
2× Phanta Max master mix25
Forward primer (10 μM)2.50.5 μM
Reverse primer (10 μM)2.50.5 μM
Template DNA (genomic)110-50 ng
Nuclease-free waterTo 50-

Cloning Procedure:

  • Design primers with appropriate restriction sites for your expression vector, similar to the approach used for other B. subtilis genes:

    • Forward primer should include a ribosome binding site and start codon

    • Reverse primer should include a stop codon and restriction site

  • PCR amplify the qoxD gene from B. subtilis subsp. spizizenii genomic DNA using high-fidelity DNA polymerase.

  • Clone the PCR product into an appropriate expression vector:

    • For E. coli expression: pET or pBAD systems

    • For B. subtilis expression: pHT or pBS vectors

  • Transform into expression host and confirm by sequencing.

  • Induce expression with appropriate inducer and optimize conditions (temperature, inducer concentration, duration) .

What purification strategies are effective for recombinant qoxD protein?

Purification of membrane proteins like qoxD requires specialized approaches:

Table 2: Recommended Purification Protocol for Recombinant qoxD

StepBuffer CompositionPurpose
1. Cell lysis50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM DTT, protease inhibitorsRelease of cellular contents
2. Membrane isolationSame as lysis bufferSeparation of membrane fraction
3. SolubilizationLysis buffer + 1-2% detergent (DDM, LDAO, or Triton X-100)Extraction of membrane proteins
4. IMAC purification50 mM Tris-HCl pH 7.5, 500 mM NaCl, 0.1% detergent, 20-500 mM imidazoleAffinity purification via His-tag
5. Size exclusion20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% detergentFinal polishing step

For membrane proteins like qoxD, it's crucial to:

  • Maintain detergent concentration above critical micelle concentration throughout purification

  • Consider using a fusion tag (His, GST, MBP) to facilitate purification

  • Perform quality control through SDS-PAGE, Western blotting, and activity assays

  • Consider reconstitution into proteoliposomes for functional studies

How can researchers assess the functional activity of recombinant qoxD?

Assessing the functional activity of qoxD requires measuring the activity of the assembled quinol oxidase complex:

  • Oxygen consumption assay: Using an oxygen electrode (Clark-type) to measure the rate of oxygen reduction in the presence of:

    • Purified recombinant qoxD (incorporated into proteoliposomes with other Qox subunits)

    • Appropriate quinol substrate (e.g., decylubiquinol)

    • Buffer system (typically pH 7.0-7.5)

  • Spectrophotometric assays: Monitor the oxidation of reduced quinols by following absorbance changes at characteristic wavelengths.

  • Reconstitution studies: Reconstitute the complete oxidase complex by combining purified qoxD with other Qox subunits and assess the assembly and activity of the complex.

  • Complementation assays: Express recombinant qoxD in qoxD-deficient B. subtilis strains and assess restoration of respiratory capacity and growth phenotype.

Research has shown that absence of functional Qox protein leads to important phenotypic alterations, providing a basis for functional complementation studies .

How should researchers analyze comparative genomic data for qoxD across different Bacillus species and strains?

Comparative genomic analysis of qoxD requires a systematic approach:

  • Sequence alignment and conservation analysis:

    • Retrieve qoxD sequences from multiple Bacillus species and strains, including the sequenced B. subtilis subsp. spizizenii strain TU-B-10T

    • Perform multiple sequence alignment using tools like MUSCLE or CLUSTAL

    • Identify conserved residues and domains, which likely represent functionally important regions

  • Phylogenetic analysis:

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Correlate evolutionary relationships with known physiological differences between species

  • Synteny analysis:

    • Compare the organization of the qox operon across species

    • Identify conservation or rearrangements in gene order

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify residues under positive or purifying selection

    • Correlate these sites with predicted functional domains

  • Structure-function correlation:

    • Map conserved residues onto predicted 3D structures

    • Identify potential functional sites based on conservation patterns

What statistical approaches are most appropriate for analyzing qoxD expression data under different experimental conditions?

For robust analysis of qoxD expression data:

  • Normalization methods:

    • For qRT-PCR: Use multiple reference genes (minimum of 3) and apply geometric averaging

    • For RNA-seq: TPM (Transcripts Per Million) or RPKM (Reads Per Kilobase Million) normalization

  • Statistical tests:

    • For comparing two conditions: Student's t-test or Mann-Whitney U test depending on data distribution

    • For multiple conditions: ANOVA followed by appropriate post-hoc tests (Tukey's HSD, Bonferroni)

    • For time-course experiments: Repeated measures ANOVA or mixed-effects models

  • Correlation analysis:

    • Pearson or Spearman correlation to identify co-regulated genes

    • Principal Component Analysis to identify major sources of variation in expression profiles

  • Visualization approaches:

    • Heatmaps for expression patterns across conditions

    • Volcano plots to visualize significant expression changes

    • Box plots or violin plots to compare expression distributions

  • Biological replication:

    • Minimum of 3 biological replicates for statistical validity

    • Power analysis to determine appropriate sample size for detecting expected effect sizes

What strategies can address poor expression of recombinant qoxD in heterologous systems?

Expressing membrane proteins like qoxD can be challenging. Consider these optimization strategies:

  • Codon optimization:

    • Adjust codon usage to match the expression host

    • Remove rare codons that might cause translational pausing

  • Expression host selection:

    • For B. subtilis expression: Use strains with reduced protease activity

    • For E. coli expression: Consider C41(DE3) or C43(DE3) strains designed for membrane protein expression

  • Fusion partners:

    • N-terminal fusions with MBP, GST, or SUMO can enhance solubility

    • Consider adding a periplasmic export signal for E. coli expression

  • Expression conditions:

    • Lower temperature (16-25°C) often improves membrane protein folding

    • Reduce inducer concentration for slower, more controlled expression

    • Use rich media supplemented with glycerol as a carbon source

  • Chassis engineering approach:

    • Consider using engineered B. subtilis chassis strains with enhanced protein expression capabilities

    • Knockout of autolysis genes (lytC, sigD, pcfA, flgD) in expression hosts can increase biomass and potentially improve protein yields

How can researchers address issues with qoxD stability during purification and functional studies?

Membrane proteins like qoxD often face stability challenges:

  • Detergent screening:

    • Test multiple detergent types (mild: DDM, LMNG; intermediate: DM; harsh: OG, LDAO)

    • Consider detergent mixtures or novel amphipols for enhanced stability

  • Buffer optimization:

    • Screen pH range (typically 6.0-8.0)

    • Test different salt concentrations (100-500 mM)

    • Add stabilizers (glycerol 10-20%, sucrose, specific lipids)

  • Thermal stability assays:

    • Use differential scanning fluorimetry (DSF) to identify stabilizing conditions

    • Nanoscale differential scanning calorimetry (nano-DSC) to measure unfolding transitions

  • Alternative approaches:

    • Styrene-maleic acid lipid particles (SMALPs) to extract membrane proteins with native lipid environment

    • Nanodisc reconstitution for a more native-like membrane environment

  • Storage considerations:

    • Avoid freeze-thaw cycles

    • Store at higher concentrations (>1 mg/mL)

    • Consider addition of reducing agents (DTT, β-mercaptoethanol) to prevent oxidation

What experimental controls are essential when studying qoxD function in the context of the complete quinol oxidase complex?

Robust controls are essential for reliable functional characterization:

  • Negative controls:

    • qoxD knockout strain

    • Inactive qoxD mutant (site-directed mutagenesis of conserved residues)

    • Assay buffer without protein or substrate

  • Positive controls:

    • Wild-type B. subtilis membranes containing native quinol oxidase

    • Purified alternative terminal oxidase with known activity

    • Complemented qoxD-deficient strain

  • Specificity controls:

    • Substrate specificity test (various quinol analogs)

    • Inhibitor sensitivity (specific quinol oxidase inhibitors)

    • Competition assays with alternative electron acceptors

  • Assembly controls:

    • Size exclusion chromatography to confirm complex formation

    • Blue native PAGE to assess complex integrity

    • Subunit stoichiometry verification through quantitative Western blotting

  • Technical replicates and validation:

    • Multiple technical replicates per biological sample

    • Validation of key findings using alternative methodological approaches

    • Statistical analysis to determine significance of observed differences

What are the most promising avenues for advancing understanding of qoxD structure-function relationships?

Several research directions could significantly advance our understanding of qoxD:

  • Structural biology approaches:

    • Cryo-electron microscopy of the complete Qox complex

    • X-ray crystallography of individual subunits including qoxD

    • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics

  • Advanced genetic techniques:

    • CRISPR-Cas9 genome editing for precise mutations

    • Suppressor mutation screens to identify functionally related genes

    • Deep mutational scanning to comprehensively map functional residues

  • Systems biology integration:

    • Multi-omics approaches to place qoxD function in broader metabolic context

    • Flux balance analysis to quantify the contribution of quinol oxidase to cellular energetics

    • Network analysis to identify regulatory relationships

  • Comparative analysis across subspecies:

    • Detailed comparison between B. subtilis subsp. subtilis and subsp. spizizenii qoxD

    • Functional studies in both backgrounds to identify subspecies-specific features

    • Hybrid complex formation to identify compatibility determinants

How might engineered variants of qoxD contribute to improved B. subtilis chassis strains for biotechnological applications?

Engineering qoxD could contribute to improved B. subtilis chassis strains through:

  • Enhanced respiratory efficiency:

    • Engineering qoxD for improved electron transport coupling could increase ATP yield

    • Modifications to alter oxygen affinity for better performance under microaerobic conditions

  • Increased stress tolerance:

    • qoxD variants with improved stability could enhance cellular resilience to environmental stresses

    • Engineering to reduce reactive oxygen species generation during respiration

  • Metabolic engineering synergies:

    • Coordinate qoxD modifications with central metabolism alterations for optimized redox balance

    • Fine-tune respiratory capacity to match biosynthetic demands for specific products

  • Chassis cell development:

    • Integration of qoxD modifications into comprehensive chassis engineering strategies

    • Combination with other improvements like deletion of autolysis genes (lytC, sigD, pcfA, flgD) that have been shown to increase biomass by 10-20%

Table 3: Potential qoxD Modifications for Chassis Strain Improvement

Modification TypePotential BenefitExperimental Approach
Increased stabilityExtended cultivation timeSite-directed mutagenesis of interface residues
Altered oxygen affinityImproved microaerobic performanceMutations in oxygen channel residues
Reduced ROS formationDecreased oxidative stressEngineering electron transfer path
Improved assemblyEnhanced respiratory capacityModification of subunit interaction domains
Increased activityHigher ATP productionDirected evolution for catalytic efficiency

Recent work demonstrates that systematic engineering of B. subtilis chassis strains can significantly improve heterologous protein production and tolerance to toxic substrates, highlighting the potential value of respiratory chain engineering as part of comprehensive chassis development strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.