Recombinant Bacillus subtilis Teichoic acid translocation permease protein tagG (tagG)

Shipped with Ice Packs
In Stock

Description

Genetic and Functional Context of TagG

Gene Operon and Essentiality

  • The tagGH operon in B. subtilis 168 encodes a two-component ABC transporter system. TagG (32.2 kDa) is a hydrophobic permease, while TagH (59.9 kDa) is an ATP-binding protein.

  • The operon is essential for cell viability, as inactivation attempts of tagG or tagH result in lethal phenotypes .

Role in Teichoic Acid Metabolism

  • TagG collaborates with TagH to translocate poly(glycerol phosphate) and poly(glucose galactosamine phosphate) WTAs or their precursors across the cytoplasmic membrane .

  • Impaired tagGH expression leads to reduced wall phosphate content, altered cell morphology (cocoid shape), and compromised WTA synthesis .

Biochemical and Localization Insights

Membrane Association

  • TagG localizes to the cytoplasmic membrane, forming helical patterns along the cell cylinder and division septa .

  • Its membrane targeting is mediated by hydrophobic interactions, critical for its role in translocating WTA precursors .

Protein Interactions

  • TagG interacts with other WTA synthesis proteins (e.g., TagO, TagB, TagF) and cytoskeletal proteins (MreC, MreD), suggesting a multiprotein "teichoic acid synthesome" .

  • Genetic studies confirm that TagG and TagH function as a dimeric transporter, with TagH hydrolyzing ATP to energize substrate translocation .

Research Findings and Applications

Key Studies

  1. Conditional Mutant Analysis: Limiting tagGH expression reduces WTA levels, confirming its role in maintaining cell wall integrity .

  2. Localization Dynamics: Fluorescent tagging revealed TagG’s association with nascent cell wall synthesis sites, colocalizing with MreB cytoskeletal structures .

  3. Recombinant TagG Utility: His-tagged TagG enables in vitro studies of WTA transport mechanisms, though tag placement (N- vs. C-terminal) may influence protein yield and activity .

Challenges in Recombinant Expression

  • His-tags at the N-terminus can enhance low-expression genes (e.g., egfp) but reduce high-expression genes (e.g., gfp+) in B. subtilis .

  • Codon optimization and promoter selection (e.g., P<sub>grac212</sub>) are critical for maximizing recombinant TagG production .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
tagG; BSU35710; Teichoic acid translocation permease protein TagG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
tagG
Target Protein Sequence
MNDLLRILREQITSFPLILRLAAYETKSKYQMNYLGVLWQFLNPLIQMLAYWFVFGMGIR KGGPVTTGAGEVPFIIWMLAGLIPWFFISPTILDGSNSVFKRINMVAKMNFPISSLPSVA IASNLFSYMIMMVIYIIVLLVNGVFPSVHWLQYIYYFICMIAFMFSFSLFNSTISVLIRD YQFLLQAVTRLLFFLLPIFWDVNAKLGQSHPELVPVLKLNPLFYIIEGFRNSFLDGAWFF HDMKYTLYFWLFTFLLLLVGSILHMKFRDKFVDFL
Uniprot No.

Target Background

Function
This protein, TagG, is part of the ABC transporter complex TagGH (TC 3.A.1.34.1), which plays a crucial role in exporting two types of intracellularly synthesized teichoic acids. It is likely responsible for the translocation of the substrate across the membrane.
Gene References Into Functions
  1. Research indicates a complex network of interactions involving TagG and the cell shape determinants MreC and MreD. TagG is part of a large multienzyme complex involved in the synthesis and export of WTA precursors. PMID: 18156271
Database Links
Protein Families
ABC-2 integral membrane protein family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TagG protein and what is its functional significance in Bacillus subtilis?

TagG is a hydrophobic 32.2 kDa integral membrane protein that forms part of the essential tagGH operon in Bacillus subtilis. It functions as a component of a two-component ABC transporter system involved in the translocation of wall teichoic acids or their precursors across the cytoplasmic membrane. TagG resembles integral membrane proteins belonging to polymer-export systems found in Gram-negative bacteria . The protein is essential for bacterial viability, as demonstrated by unsuccessful attempts to inactivate tagG through insertional mutagenesis .

The TagG-TagH complex facilitates the transport of both poly(glycerol phosphate) and poly(glucose galactosamine phosphate) teichoic acids, which are critical components of the B. subtilis cell wall structure. When tagGH expression is limited, cells exhibit altered morphology (becoming cocoid) and show reduced phosphate and galactosamine content in their cell walls, confirming the protein's essential role in teichoic acid metabolism .

How is the tagGH operon organized in the Bacillus subtilis genome?

The tagGH operon is located in the 308° chromosomal region of B. subtilis 168, which contains multiple genes involved in teichoic acid biosynthesis. The operon is controlled by a σA-dependent promoter, indicating its constitutive expression under normal growth conditions .

The operon consists of two genes:

  • tagG - encodes the 32.2 kDa hydrophobic membrane component

  • tagH - encodes a 59.9 kDa protein with an ATP-binding motif in its N-terminal region

This genetic organization reflects the functional relationship between the two proteins, with TagG serving as the membrane channel component and TagH providing the energy for transport through ATP hydrolysis. The tagH gene product shares extensive homology with ATP-binding proteins associated with the transport of capsular polysaccharides and O-antigens in other bacterial species .

What experimental approaches can be used to study TagG localization and expression?

TagG localization and expression can be studied using several methodological approaches:

  • Fluorescent protein tagging: The pBacTag-GFP+ vector system enables the creation of a chromosomal TagG-GFP fusion protein by homologous recombination. This approach allows for real-time visualization of TagG localization within living B. subtilis cells .

  • Epitope tagging: Various epitope tags can be fused to the 3'-end of the tagG gene using pBacTag vectors, enabling detection with commercially available antibodies. This is particularly useful for immunofluorescence microscopy or western blot analysis .

  • Controlled expression systems: The integration of inducible promoters upstream of tagG allows for controlled expression levels, facilitating studies of TagG dosage effects on cell morphology and wall teichoic acid content .

The experimental workflow typically involves cloning the 3' portion of tagG into the appropriate pBacTag vector, transforming B. subtilis, selecting transformants using erythromycin resistance, and confirming correct integration by PCR and sequencing .

What are the optimal conditions for expressing and purifying recombinant TagG protein?

Recombinant TagG protein expression and purification require specialized approaches due to its hydrophobic nature as a membrane protein. The following methodological guidelines are recommended:

Expression Systems:

  • E. coli expression: TagG can be expressed as a His-tagged recombinant protein in E. coli systems, achieving >80% purity as determined by SDS-PAGE analysis .

  • Yeast expression: Alternative expression in yeast systems may provide advantages for proper folding of this membrane protein .

Purification Strategy:

  • Solubilization: Membrane fraction isolation followed by solubilization using appropriate detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS)

  • Affinity purification: His-tagged TagG can be purified using immobilized metal affinity chromatography (IMAC)

  • Buffer optimization: PBS buffer is recommended for storage of purified TagG protein

Storage Conditions:

  • Short-term storage: +4°C

  • Long-term storage: -20°C to -80°C in PBS buffer

The expression and purification process typically yields TagG protein with >80% purity, though custom optimization may be required for specific experimental applications .

How can researchers assess the functionality of TagG protein in vitro and in vivo?

Functional assessment of TagG protein can be approached through complementary in vitro and in vivo methods:

In vitro functional assays:

  • Reconstitution in proteoliposomes: Purified TagG and TagH proteins can be incorporated into artificial lipid bilayers to study teichoic acid translocation directly

  • ATPase activity assays: Measuring ATP hydrolysis rates of the TagG-TagH complex in the presence of teichoic acid substrates

  • Binding assays: Using surface plasmon resonance or isothermal titration calorimetry to quantify interactions between TagG and teichoic acid precursors

In vivo functional assessment:

  • Conditional expression systems: By placing tagG under an inducible promoter, researchers can correlate TagG expression levels with teichoic acid content and cell morphology

  • Morphological analysis: Limited tagGH expression results in cocoid cell morphology that can be quantified microscopically

  • Cell wall composition analysis: Measuring phosphate and galactosamine content in cell walls provides direct evidence of TagG functionality in teichoic acid translocation

Quantitative parameters for functional assessment:

  • Reduction in cell wall phosphate content correlates with decreased TagG activity

  • Changes in galactosamine levels indicate impaired poly(glucose galactosamine phosphate) teichoic acid transport

  • Transition to cocoid morphology serves as a visible indicator of compromised TagG function

What are the implications of TagG mutations for bacterial cell wall integrity and antimicrobial resistance?

TagG mutations have significant implications for bacterial physiology and potential therapeutic strategies:

Cell Wall Integrity:

  • Complete loss of TagG function is lethal, demonstrating its essential role in cell viability

  • Partial reduction in TagG activity leads to:

    • Altered cell morphology (cocoid form)

    • Reduced teichoic acid content in the cell wall

    • Compromised cell wall integrity and stability

Antimicrobial Resistance Considerations:

  • Teichoic acid translocation represents a potential target for novel antimicrobial development

  • TagG inhibitors could potentially synergize with existing cell wall-targeting antibiotics

  • The essential nature of TagG makes it an attractive target for antimicrobial development

Research Applications:

  • Structure-based drug design targeting the TagG-TagH interface

  • High-throughput screening for small molecule inhibitors of teichoic acid translocation

  • Development of combination therapies that simultaneously target multiple cell wall biosynthesis pathways

Understanding TagG mutations provides insight into fundamental aspects of bacterial cell wall biosynthesis while simultaneously offering opportunities for antimicrobial development strategies.

How does TagG interact with other components of the teichoic acid synthesis pathway?

TagG functions within a complex network of proteins involved in teichoic acid synthesis, polymerization, and export:

Key TagG Interactions:

  • TagH interaction: TagG forms a functional complex with TagH, where TagG provides the membrane channel and TagH supplies ATP-dependent energy for translocation

  • Teichoic acid precursor interactions: TagG recognizes and translocates specific teichoic acid precursors synthesized by other Tag proteins

  • Cell division machinery: The localization and function of TagG may be coordinated with cell division proteins to ensure proper cell wall synthesis during growth

Integrated Pathway Context:
The TagG-TagH complex operates downstream of the teichoic acid synthesis machinery, consisting of:

  • TagA, TagB, TagD, and TagF for poly(glycerol phosphate) synthesis

  • TagO, TagA, and TagB for poly(glucose galactosamine phosphate) synthesis

The translocation function of TagG-TagH represents a critical checkpoint in teichoic acid incorporation into the cell wall, and disruption at this stage affects the entire teichoic acid biosynthesis pathway.

What genetic manipulation techniques are most effective for studying tagG function?

Several genetic approaches have proven valuable for studying tagG function:

Chromosomal Integration and Tagging:
The pBacTag vector system enables precise genetic manipulation of tagG through:

  • Specific gene inactivation for phenotypic analysis

  • Creation of translational fusions with epitope or localization tags

  • Integration via homologous recombination into the B. subtilis chromosome

Transformation Protocols:
Two effective transformation protocols for B. subtilis genetic manipulation:

Protocol A:

  • Grow cells in LB medium at 37°C to OD600 = 0.5-0.6

  • Dilute culture 1:100 in MDCH medium

  • Incubate at 37°C with vigorous shaking for 4 hours

  • Add DNA and continue incubation for 1 hour

  • Plate on selective media

Protocol B:

  • Grow cells in SpC medium at 37°C to early stationary phase

  • Dilute 1:10 in SpII medium

  • Incubate for 90 minutes

  • Centrifuge and resuspend in SpII + glycerol

  • Add DNA and incubate for 30 minutes

  • Add expression mix and plate on selective media

These genetic approaches allow researchers to create precisely modified versions of tagG for functional studies while maintaining chromosomal context and physiological expression levels.

What analytical techniques are recommended for studying TagG protein structure and function?

Multiple analytical approaches provide complementary insights into TagG structure and function:

Structural Analysis:

  • X-ray crystallography: Challenging for membrane proteins like TagG, but potentially feasible with detergent solubilization or lipidic cubic phase crystallization

  • Cryo-electron microscopy: Increasingly valuable for membrane protein structure determination, especially for the TagG-TagH complex

  • Molecular dynamics simulations: Computational modeling of TagG structure and substrate interactions based on homology models

Functional Analysis:

  • Membrane vesicle transport assays: Measuring translocation of labeled teichoic acid precursors

  • Site-directed mutagenesis: Systematic modification of key residues to identify essential functional domains

  • Crosslinking studies: Identification of TagG interaction partners within the cell envelope

Expression and Localization:

  • Fluorescence microscopy: Using TagG-GFP fusions to track protein localization in living cells

  • Immunoblotting: Quantification of TagG expression levels using epitope-tagged variants

  • Membrane fractionation: Biochemical verification of TagG localization within specific membrane domains

These methodological approaches provide a comprehensive toolkit for investigating the structural and functional aspects of TagG protein in the context of teichoic acid translocation.

What are the unresolved questions regarding TagG function and regulation?

Despite significant progress in understanding TagG, several important questions remain unresolved:

Structural Questions:

  • What is the three-dimensional structure of the TagG-TagH complex?

  • How does TagG recognize specific teichoic acid precursors versus other polymers?

  • What conformational changes occur during the translocation cycle?

Regulatory Questions:

  • How is tagGH expression coordinated with other teichoic acid synthesis genes?

  • Are there post-translational modifications that regulate TagG activity?

  • How is TagG activity integrated with cell division and growth processes?

Evolutionary Questions:

  • How conserved is TagG function across different Gram-positive bacterial species?

  • What structural adaptations exist for translocating diverse teichoic acid compositions?

  • Could TagG homologs in pathogens represent novel antimicrobial targets?

Addressing these questions requires integrative approaches combining structural biology, genetics, biochemistry, and computational modeling.

How can advanced research tools be applied to study TagG-TagH interactions?

Cutting-edge research tools offer new opportunities to investigate the TagG-TagH transporter complex:

Protein-Protein Interaction Studies:

  • Förster resonance energy transfer (FRET): Measuring interactions between fluorescently tagged TagG and TagH proteins in vivo

  • Split protein complementation assays: Confirming direct interactions through functional reconstitution

  • Co-immunoprecipitation with mass spectrometry: Identifying additional components of the TagG-TagH complex

Advanced Imaging Technologies:

  • Super-resolution microscopy: Visualizing TagG-TagH distribution at nanometer resolution

  • Single-molecule tracking: Following individual TagG-TagH complexes during translocation events

  • Correlative light and electron microscopy: Connecting protein localization with cellular ultrastructure

Computational Approaches:

  • Molecular docking: Predicting TagG-TagH interaction interfaces

  • Systems biology models: Integrating TagG-TagH function into whole-cell models of teichoic acid synthesis

  • Evolutionary analysis: Identifying conserved functional domains through comparative genomics

These advanced tools promise to reveal dynamic aspects of TagG-TagH function that have been challenging to observe with conventional methods.

Comparative Properties of TagG and Related ABC Transporter Components

PropertyTagGTagHSimilar Transporters
Molecular Weight32.2 kDa59.9 kDaVaries by system
FunctionMembrane channelATP-binding componentSimilar division of labor
Cellular LocalizationIntegral membraneMembrane-associatedTypically membrane-bound
HomologyResembles Gram-negative polymer export systemsHomologous to ATP-binding cassettes for polysaccharide transportCommon ABC transporter architecture
EssentialityEssential for viabilityEssential for viabilityVariable essentiality
Lethality of InactivationLethalLethal (5'-moiety)System-dependent
UniProt IDP42953Not specified in sourcesN/A

This table summarizes key properties of TagG and TagH proteins based on research findings .

Expression and Purification Parameters for Recombinant TagG Protein

ParameterRecommended ConditionNotes
Expression SystemE. coli or YeastCustom production typically required
TagHis-tagFacilitates purification via IMAC
Expression FormFull-length or partial proteinApplication-dependent
Purification MethodNot specified in sourcesLikely IMAC for His-tagged protein
Final FormLiquid or lyophilized powderApplication-dependent
Endotoxin Level< 1.0 EU per μg proteinDetermined by LAL method
Purity> 80% by SDS-PAGEMay require optimization
Storage BufferPBS bufferMaintains stability
Short-term Storage+4°CFor immediate use
Long-term Storage-20°C to -80°CFor extended preservation
Production Time5-9 weeksFor custom production

This table provides guidance for researchers working with recombinant TagG protein based on available product specifications .

Effects of TagG/TagH Limitation on Bacillus subtilis Cellular Properties

ParameterNormal ExpressionLimited ExpressionSignificance
Cell MorphologyRod-shapedCocoidIndicates cell wall defects
Cell Wall Phosphate ContentNormal levelsReducedReflects impaired poly(glycerol phosphate) teichoic acid incorporation
Cell Wall Galactosamine ContentNormal levelsReducedIndicates impaired poly(glucose galactosamine phosphate) teichoic acid incorporation
Growth RateNormalReducedEssential nature of TagG function
ViabilityHighCompromisedCritical role in cell wall integrity

This table summarizes the phenotypic consequences of limited tagGH expression, highlighting the critical role of these proteins in maintaining proper cell wall structure and composition .

What are the emerging research directions for TagG and teichoic acid translocation?

The study of TagG continues to evolve with several promising research directions:

  • Structural characterization: Determining high-resolution structures of the TagG-TagH complex would provide critical insights into the mechanism of teichoic acid translocation

  • Development of specific inhibitors: The essential nature of TagG makes it an attractive target for antimicrobial development

  • Systems biology approaches: Integrating TagG function into comprehensive models of cell wall biosynthesis

  • Comparative studies across bacterial species: Understanding how teichoic acid translocation mechanisms vary among different Gram-positive bacteria

  • Synthetic biology applications: Engineering TagG-TagH systems for the production of modified cell wall polymers with novel properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.