Recombinant Bacillus subtilis Teichuronic acid biosynthesis protein tuaF (tuaF)

Shipped with Ice Packs
In Stock

Description

Introduction

The Bacillus subtilis Teichuronic acid biosynthesis protein TuaF (TuaF) is involved in the synthesis of teichuronic acid, an essential component of the cell wall in gram-positive bacteria such as Bacillus subtilis . Teichuronic acids are anionic polymers that play a vital role in maintaining cell wall structure, regulating cell division, and participating in interactions with the environment . The nature of the anionic polymer present in the cell wall of B. subtilis depends on phosphate availability .

Function of TuaF

TuaF is a protein involved in teichuronic acid biosynthesis . Specifically, TuaF functions in the formation of poly(ribitol phosphate) wall teichoic acid in S. aureus .

Teichoic acid biosynthesis begins with the formation of an undecaprenyl-pyrophosphoryl disaccharide on the cytoplasmic face of the cell membrane through the successive action of proteins TarO (*N-*acetylglucosamine-1-phosphate transferase) and TarA (N-acetylmannosamine transferase) . Subsequently a primase (TarB) and oligomerase (TarF) are believed to add a trimer of 1,3-linked glycerol-3-phosphate units to the 4-hydroxyl of N-acetylmannosamine . Glycerol-3-phosphate is provided by the action of TarD in an activated form, CDP-glycerol . Analogously, TarK and TarL have been proposed to prime and polymerize, respectively, a 1,5-linked polymer (∼30 units) of ribitol-5-phosphate on the terminal hydroxyl of the trimer of glycerol phosphate . TarIJ provides activated ribitol-5-phosphate in the form of CDP-ribitol . Intracellular synthesis of the complete polymer is thought to be followed by extrusion by TarGH, an ABC transporter, before transfer to the 6-hydroxyl of N-acetylmuramic acid moiety of peptidoglycan by an unknown transferase .

Role in Antibacterial Activity

Given the importance of teichoic acids in bacterial cell wall structure and function, proteins involved in their synthesis, like TuaF, can be potential targets for antibacterial agents . Some studies have explored the antibacterial activities of compounds against Staphylococcus aureus . Lesions in teichoic acid biosynthesis can lead to a lethal gain of function in the otherwise dispensable pathway . Later-acting gene products (TarB, TarD, TarF, TarIJ, and TarH) responsible for polymer formation and export are essential for viability .

Research Findings

Research has demonstrated that teichoic acid biosynthetic enzymes in S. aureus are essential for viability . Studies using allelic replacement methodology showed that while the first-acting enzyme (TarO) was dispensable for growth, later-acting gene products (TarB, TarD, TarF, TarIJ, and TarH) responsible for polymer formation and export were essential for viability . This paradox was resolved by demonstrating that all of the apparently indispensable genes became dispensable in a tarO null genetic background, suggesting a lethal gain-of-function mechanism where lesions beyond the initial step in wall teichoic acid biosynthesis render S. aureus nonviable .

Tables

ProteinFunction
TarO*N-*acetylglucosamine-1-phosphate transferase; initiates teichoic acid biosynthesis by forming an undecaprenyl-pyrophosphoryl disaccharide on the cytoplasmic face of the cell membrane.
TarAN-acetylmannosamine transferase; involved in the formation of an undecaprenyl-pyrophosphoryl disaccharide.
TarBPrimase; adds a trimer of 1,3-linked glycerol-3-phosphate units to the 4-hydroxyl of N-acetylmannosamine.
TarFOligomerase; works with TarB to add a trimer of 1,3-linked glycerol-3-phosphate units to the 4-hydroxyl of N-acetylmannosamine.
TarDProvides glycerol-3-phosphate in an activated form (CDP-glycerol).
TarKPrimase; primes a 1,5-linked polymer of ribitol-5-phosphate on the terminal hydroxyl of the trimer of glycerol phosphate.
TarLPolymerase; polymerizes a 1,5-linked polymer of ribitol-5-phosphate on the terminal hydroxyl of the trimer of glycerol phosphate.
TarIJProvides activated ribitol-5-phosphate in the form of CDP-ribitol.
TarGHABC transporter; responsible for the extrusion of the complete polymer.
TuaFInvolved in the synthesis of teichuronic acid, an essential component of the cell wall in gram-positive bacteria. Functions in the formation of poly(ribitol phosphate) wall teichoic acid in S. aureus.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tuaF; yvhF; BSU35560; Teichuronic acid biosynthesis protein TuaF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
tuaF
Target Protein Sequence
MNDILIRIARRIKKNIIWIIAVPIILGAAGYILPSQIADQKSYTAEDTLAVGSYDHPVYN STEEIPLLLKSDSFLKEALPDEKDEDVAEIKEKLTINTESKSLLTLSYSDEDKDRTESVL NAISSTFLKNDQKLYAEREAVIRSSIDALEGESVSEDSKVDKERFLYELKNTQLNLKAAS VTDSETVSETAGGGMSPKKKAVLGVMIGLTIAFMFVVIPEFFRESF
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the teichuronic acid biosynthesis protein TuaF and what is its role in Bacillus subtilis?

TuaF is a protein encoded within the tuaABCDEFGH operon of Bacillus subtilis 168, which is responsible for the biosynthesis of teichuronic acid, a major anionic polymer in the bacterial cell wall. This operon encodes enzymes required for both the polymerization of teichuronic acid and the synthesis of its precursor, UDP-glucuronate. TuaF specifically contributes to the assembly and incorporation of teichuronic acid into the cell wall structure . The teichuronic acid operon is part of the Pho regulon, with its transcription being induced under phosphate-limiting conditions, indicating its role in phosphate homeostasis and adaptation to environmental stress .

How is the expression of tuaF regulated in Bacillus subtilis?

The tuaF gene, as part of the tuaABCDEFGH operon, is primarily regulated by phosphate availability in the environment. This operon belongs to the Pho regulon, which means its transcription is induced when phosphate becomes limited in the growth medium. Experimental evidence has shown that placing the tuaABCDEFGH operon under the control of an inducible promoter (Pspac) allows for constitutive expression independent of phosphate concentration, with the level of uronic acid in cell walls directly correlating with inducer concentration . This regulation mechanism highlights the adaptive response of B. subtilis to nutrient availability, where teichuronic acid production increases to potentially compensate for reduced teichoic acid synthesis under phosphate-limited conditions.

What is the relationship between teichuronic acid and teichoic acid in the Bacillus subtilis cell wall?

In B. subtilis, there exists an interdependent relationship between teichuronic acid and teichoic acid incorporation into the cell wall. Under phosphate-limited conditions, cells reduce the synthesis of phosphate-rich teichoic acids and increase the production of teichuronic acid, which contains no phosphate. Research has demonstrated that this balance is carefully maintained to ensure a constant level of negative charge in the cell wall . Similar to teichoic acids in other gram-positive bacteria, teichuronic acid likely contributes to the proton-binding capacity of the cell wall, which influences autolytic activity and cell wall integrity. This functional relationship suggests a sophisticated regulatory mechanism that ensures cell envelope homeostasis despite changing environmental conditions .

How can recombinant TuaF protein be expressed and purified for biochemical characterization?

Expression and purification of recombinant TuaF can be approached using strategies similar to those employed for related cell wall biosynthesis proteins. A hexahistidine-tag fusion system in E. coli has proven effective for the purification of related proteins such as TagF . For TuaF expression:

  • Gene cloning: The tuaF gene should be PCR-amplified from B. subtilis genomic DNA using high-fidelity DNA polymerase and specific primers containing appropriate restriction sites.

  • Expression vector construction: The amplified gene should be inserted into an expression vector (such as pET series) containing a strong inducible promoter and an affinity tag (His6-tag) for purification.

  • Transformation and expression: Transform the construct into an appropriate E. coli strain (BL21(DE3) or derivatives) and optimize expression conditions including temperature (typically 16-30°C), inducer concentration, and induction time.

  • Protein purification: Purify the expressed protein using nickel-affinity chromatography, with subsequent size-exclusion chromatography to ensure high purity.

  • Activity verification: Develop a specific activity assay, potentially based on the incorporation of radioactively labeled precursors into membrane fractions, similar to the membrane pelleting assay developed for TagF .

This methodology would enable biochemical and structural characterization of TuaF to understand its substrate specificity, kinetic parameters, and mechanism of action.

What experimental approaches can be used to study the enzymatic activity of TuaF in vitro?

The enzymatic activity of TuaF can be investigated through several complementary approaches:

  • Radioactive substrate incorporation assay: Develop an assay similar to that used for TagF, where incorporation of radioactively labeled precursors (likely UDP-[14C]glucuronate) into a membrane fraction is monitored. This would require purified TuaF protein, appropriate substrate, and a membrane fraction from B. subtilis as an acceptor .

  • HPLC analysis: High-performance liquid chromatography can be used to analyze the polymeric nature of the reaction products, determining the length and composition of the synthesized teichuronic acid chains .

  • Kinetic parameter determination: Establish the saturation kinetics for TuaF by varying substrate concentration and measuring initial reaction rates to determine KM and Vmax values for all substrates involved in the polymerization reaction.

  • Substrate specificity analysis: Test various UDP-sugar derivatives to determine the substrate specificity of TuaF and identify potential competitive inhibitors.

  • pH and temperature dependence: Characterize the optimal conditions for TuaF activity, which can provide insights into its physiological role and mechanism.

These approaches would provide comprehensive characterization of TuaF's enzymatic properties and contribute to understanding its role in teichuronic acid biosynthesis.

How does TuaF contribute to B. subtilis adaptation to phosphate-limited environments?

TuaF, as part of the teichuronic acid biosynthesis machinery, plays a crucial role in B. subtilis adaptation to phosphate limitation through several mechanisms:

  • Resource allocation: By contributing to teichuronic acid synthesis (phosphate-free) instead of teichoic acid (phosphate-rich), TuaF helps conserve phosphate for essential cellular processes under limiting conditions .

  • Cell wall integrity maintenance: Experimental evidence with tua operon mutants shows that cells deficient in any of the tua genes, including tuaF, exhibit reduced amounts of uronate in their cell walls when grown under phosphate limitation. This suggests that TuaF is essential for maintaining cell wall integrity during phosphate stress .

  • Charge homeostasis: The balance between teichoic and teichuronic acids maintains a constant level of negative charge in the cell wall. TuaF contributes to this balance by enabling teichuronic acid incorporation when teichoic acid synthesis is reduced .

  • Growth sustainability: By facilitating the switch to teichuronic acid production, TuaF helps sustain growth under conditions where continued teichoic acid synthesis would be metabolically unsustainable due to phosphate scarcity.

This adaptive response represents a sophisticated resource management strategy that allows B. subtilis to thrive in diverse environmental conditions.

What genetic approaches can be used to study TuaF function in vivo?

Several genetic approaches can be employed to investigate TuaF function in vivo:

  • Knockout and complementation studies: Generate a tuaF deletion mutant and assess phenotypic changes, particularly under phosphate limitation. Complementation with wild-type and mutant tuaF variants can confirm gene-phenotype relationships . This approach has been successfully used for studying related proteins like TagF, where thermosensitive mutations were complemented by conditional expression under the xylose promoter at the amyE locus .

  • Conditional expression systems: Place tuaF under control of an inducible promoter (such as Pspac or Pxyl) to study dose-dependent effects of TuaF expression on teichuronic acid synthesis and cell physiology, independent of phosphate availability .

  • Point mutations and domain analysis: Introduce specific mutations to identify catalytic residues and functional domains within TuaF. This can be accomplished using site-directed mutagenesis followed by functional complementation assays.

  • Reporter gene fusions: Create transcriptional and translational fusions with reporter genes (GFP, lacZ) to monitor tuaF expression patterns under various conditions and in different genetic backgrounds.

  • Chassis strain construction: Utilize genome engineering approaches similar to those described for B. subtilis chassis strain development to create optimized backgrounds for studying TuaF function . This could include deleting competing pathways or modifying cell properties to enhance phenotypic readouts.

These genetic tools provide complementary approaches to unravel the physiological role and regulation of TuaF in the context of the living cell.

How can the interaction between TuaF and other proteins in the teichuronic acid biosynthesis pathway be studied?

Investigating protein-protein interactions involving TuaF requires multiple complementary approaches:

  • Bacterial two-hybrid system: Adapt systems like the bacterial adenylate cyclase two-hybrid (BACTH) system to screen for direct interactions between TuaF and other Tua proteins. This approach is particularly suitable for membrane-associated proteins like those involved in cell wall biosynthesis.

  • Co-immunoprecipitation (Co-IP): Express epitope-tagged TuaF in B. subtilis and perform Co-IP followed by mass spectrometry to identify interaction partners. This can be enhanced by crosslinking approaches to capture transient interactions.

  • Pull-down assays: Use purified recombinant His-tagged TuaF as bait in pull-down experiments with B. subtilis membrane fractions or cell lysates to identify interacting proteins.

  • Fluorescence microscopy with protein fusions: Create fluorescent protein fusions to visualize co-localization of TuaF with other Tua proteins in living cells, potentially using super-resolution microscopy techniques.

  • Genetic suppressor analysis: Identify suppressor mutations that rescue phenotypes of tuaF mutants, which may reveal functional interactions between TuaF and other cellular components.

  • Protein complex reconstitution: Attempt in vitro reconstitution of the teichuronic acid biosynthesis complex using purified components to study assembly dynamics and functional interactions, similar to approaches used for TagF characterization .

These methods would provide insights into how TuaF coordinates with other enzymes in the biosynthetic pathway and potentially reveal regulatory interactions.

What analytical methods are most effective for studying teichuronic acid production and structure in wild-type versus tuaF mutant strains?

Several analytical methods can effectively characterize teichuronic acid production and structure:

Table 1: Analytical Methods for Teichuronic Acid Characterization

MethodApplicationAdvantagesLimitations
High-Performance Liquid Chromatography (HPLC)Polymer length analysis, composition determinationQuantitative, can determine polymer length distributionsMay require specific derivatization strategies
Nuclear Magnetic Resonance (NMR) SpectroscopyDetailed structural analysis, linkage determinationProvides atomic-level structural informationRequires purified samples, relatively large amounts
Mass Spectrometry (MS)Molecular weight determination, composition analysisHigh sensitivity, can detect modificationsComplex spectra for heterogeneous polymers
Colorimetric Uronic Acid AssaysQuantification of total uronic acid contentSimple, suitable for high-throughput analysisLimited structural information
Cell Wall FractionationIsolation of cell wall componentsSeparates teichuronic acid from other polymersLabor-intensive, may alter native structures
Electron MicroscopyCell wall ultrastructure visualizationDirect observation of cell wall changesLimited chemical specificity

For comparative studies between wild-type and tuaF mutants, a combination of:

  • Quantitative analysis: Measure uronic acid content in isolated cell walls using colorimetric assays to determine total teichuronic acid production .

  • Structural characterization: Employ HPLC and MS to analyze the length and composition of teichuronic acid polymers extracted from cell walls .

  • Functional assessment: Evaluate the negative charge distribution in the cell wall through proton-binding capacity measurements, similar to those developed for teichoic acids .

  • In vivo labeling: Use radioactive or fluorescent precursors to track the incorporation of teichuronic acid into growing cell walls in real-time.

These approaches would comprehensively characterize the effects of tuaF mutations on teichuronic acid biosynthesis and cell wall properties.

How can recombinant B. subtilis strains be engineered for improved expression and study of TuaF?

Engineering B. subtilis strains for optimized TuaF expression and characterization can leverage several strategies:

  • Lifespan engineering: Implement approaches for extending bacterial cell lifespan through deletion of autolysis-related genes such as lytC, sigD, pcfA, and flgD, which have been shown to increase biomass by 10-20% . This approach can enhance protein production by maintaining viable cells for longer periods.

  • Chassis optimization: Develop specialized chassis strains by systematic genome modification to reduce background interference and improve protein expression. This may include deleting competing pathways or non-essential genomic regions that can interfere with TuaF activity analysis .

  • Expression system design: Implement well-characterized inducible promoter systems such as Pspac or Pxyl promoters to achieve controlled expression of tuaF . Fine-tuning expression levels can be critical for functional studies.

  • Secretion enhancement: For secreted forms of TuaF, optimize signal peptides and modify the cell wall through targeted deletions (e.g., dltABCD) to increase membrane permeability and improve protein secretion efficiency .

  • Codon optimization: Adjust the codon usage of recombinant tuaF to match B. subtilis preferred codons, potentially improving translation efficiency and protein yield.

  • Two-stage cultivation strategy: Implement a DO-stat fed-batch fermentation strategy with two-stage seed expansion culture to maximize biomass and protein production, as demonstrated for other recombinant proteins in B. subtilis .

These engineering approaches can be combined to create optimized B. subtilis platforms for studying TuaF function and producing the protein for structural and biochemical analyses.

What are the current knowledge gaps and future research directions regarding TuaF and teichuronic acid biosynthesis?

Despite significant advances in understanding teichuronic acid biosynthesis, several important knowledge gaps remain regarding TuaF:

  • Structural characterization: Unlike TagF, which has been extensively characterized , the three-dimensional structure of TuaF has not been determined, limiting our understanding of its catalytic mechanism and substrate binding.

  • Precise enzymatic role: While TuaF is known to be involved in teichuronic acid biosynthesis, its exact catalytic function within the pathway (e.g., polymerase, transferase) needs further elucidation through direct biochemical characterization.

  • Regulation mechanisms: The fine details of how TuaF activity is regulated beyond transcriptional control remain unclear, including potential post-translational modifications or allosteric regulation.

  • Interaction network: The protein-protein interaction network involving TuaF in the biosynthetic machinery is not fully mapped, leaving questions about how the biosynthetic complex is assembled and coordinated.

  • Evolutionary relationships: Comparative analysis with related proteins across bacterial species could provide insights into the evolution of cell wall polymer biosynthesis systems and identify conserved functional elements.

Future research should focus on:

  • Developing in vitro activity assays specifically for TuaF to characterize its enzymatic properties

  • Solving the crystal structure of TuaF to understand its catalytic mechanism

  • Mapping the complete protein interaction network of the teichuronic acid biosynthesis complex

  • Investigating the potential of TuaF as a target for antimicrobial development

  • Exploring the application of engineered TuaF variants in biotechnology, potentially for the synthesis of novel glycopolymers with useful properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.