Recombinant Bacillus subtilis Thiol-disulfide oxidoreductase resA (resA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant enzymes play a crucial role in biopharmaceutical production, facilitating key processes at each stage of the workflow . Among these enzymes is the thiol-disulfide oxidoreductase ResA from Bacillus subtilis, an enzyme involved in the maturation of c-type cytochromes . Specifically, ResA is essential for the covalent attachment of heme cofactors to apocytochromes via thioether bonds, a process unique to c-type cytochrome maturation .

ResA Function and Specificity

ResA is an extracytoplasmic membrane-bound protein required for cytochrome c maturation in Bacillus subtilis . Unlike many other thiol-disulfide oxidoreductases, ResA exhibits specificity for cytochrome c550 and uses alternate conformations to recognize redox partners .

  • Cytochrome c Maturation: ResA facilitates the reduction of oxidized apocytochrome c, preparing it for heme insertion .

  • Redox-Dependent Conformational Change: ResA undergoes conformational changes between oxidation states, utilizing a surface cavity present in the reduced state to recognize a peptide derived from cytochrome c550 .

  • Specificity: ResA preferentially reduces an oxidized C-x-x-C-H motif within a mimetic peptide from cytochrome c550, confirming its specificity as a thiol-disulfide oxidoreductase .

Mechanism of Substrate Specificity

ResA's mechanism involves redox-coupled conformational changes to select its substrate . ResA acts as a control point, directing electrons for cytochrome c maturation only when apocytochrome c is available . The reduced form of ResA specifically binds oxidized apocytochrome c, preventing electron loss to random disulfides .

Role in Thiol-Oxidizing Capacity

Bacillus subtilis has limited capacity for disulfide bond formation, which is important for protein folding, structural integrity, and activity . Decreasing the levels of cytoplasmic thiol-disulfide oxidoreductases with reductase activity, such as TrxA, can increase the yield of secreted proteins . This can be further improved by introducing staphylococcal DsbA, a strong bacterial thiol oxidase, and by including redox-active compounds in the growth medium .

Applications of Recombinant Enzymes

Recombinant enzymes like ResA have diverse applications, including :

  • Therapeutic Protein Production: Recombinant DNA technology is used to produce insulin and growth hormones .

  • Diagnostic Applications: Recombinant enzymes are used in PCR to amplify DNA for diagnosing genetic disorders and infectious diseases . They are also used in ELISA to detect diseases through color changes .

  • Drug Discovery: Recombinant enzymes are used in in vitro assays for reaction phenotyping and enzyme inhibition studies .

  • Vaccine Development: Recombinant Bacillus subtilis expressing specific proteins can induce immune responses, as demonstrated with the PEDV spike protein .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
resA; ypxA; BSU23150; Thiol-disulfide oxidoreductase ResA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
resA
Target Protein Sequence
MKKKRRLFIRTGILLVLICALGYTIYNAVFAGKESISEGSDAPNFVLEDTNGKRIELSDL KGKGVFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVN FPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPGETSG
Uniprot No.

Target Background

Function
This thiol-disulfide oxidoreductase is essential for disulfide bond reduction during c-type cytochrome synthesis. It may receive reducing equivalents from CcdA, facilitating disulfide bond cleavage in apocytochrome c, enabling subsequent heme attachment. It does not participate in sporulation.
Gene References Into Functions
  1. This study biochemically demonstrates the specificity of ResA. PMID: 16537372
  2. The conformational features of ResA enhancing its substrate specificity are reported. PMID: 16971393
  3. In vivo redox and acid-base properties of ResA active-site dipeptide variants show significant differences compared to the wild-type protein. PMID: 18422485
  4. Data indicate the importance of ResA's active-site cysteinyls and hydrophobic cavity residues for cytochrome c maturation in *Bacillus subtilis*. PMID: 18456809
Database Links

KEGG: bsu:BSU23150

Protein Families
Thioredoxin family, ResA subfamily
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Note=The thioredoxin-like motif is exposed on the outside of the membrane.

Q&A

What is ResA and what is its primary function in Bacillus subtilis?

ResA is a membrane-associated thiol-disulfide oxidoreductase in Bacillus subtilis with its thioredoxin-like domain located on the outside of the cytoplasmic membrane. Its primary function is to catalyze the reduction of disulfide bonds in apocytochrome c, which is essential for the maturation of c-type cytochromes. ResA contains two redox-reactive cysteine residues with a midpoint potential of approximately -340 mV at pH 7, enabling it to function as a reducing agent in the cytochrome c maturation pathway . This reduction is critical as it prepares the apocytochrome for heme attachment, as the covalent binding of heme to apocytochromes requires two reduced cysteinyls at the heme binding site .

How does ResA contribute to cytochrome c maturation?

ResA plays a crucial role in the cytochrome c maturation (CCM) process by maintaining the heme-binding cysteines of apocytochrome c in a reduced state outside the cytoplasmic membrane. In bacterial systems, c-type cytochromes are synthesized with a signal sequence that directs them to be transported across the cytoplasmic membrane. After translocation, the apocytochrome's cysteine residues can become oxidized in the oxidizing environment outside the membrane. ResA, along with another thiol-disulfide oxidoreductase called CcdA, functions to reduce these disulfide bonds in the heme-binding motif, allowing the thiol groups to form thioether bonds with the vinyl groups of heme . This process is essential for proper cytochrome maturation, as demonstrated by the fact that ResA-deficient B. subtilis strains lack c-type cytochromes .

What experimental approaches can confirm the role of ResA in cytochrome c maturation?

Several complementary experimental approaches can be used to confirm ResA's role in cytochrome c maturation:

  • Gene knockout studies: Creating a ResA-deficient B. subtilis strain and observing the absence of c-type cytochromes.

  • Complementation assays: Restoring cytochrome c synthesis in ResA-deficient mutants through:

    • In trans expression of the resA gene

    • Inducing deficiency in BdbD (which normally oxidizes apocytochrome c)

    • Addition of exogenous reductants like dithiothreitol to the growth medium

  • Membrane topology analysis: Determining the localization of ResA's thioredoxin-like domain on the outside of the cytoplasmic membrane through protease accessibility assays or reporter fusion proteins.

  • Redox potential measurements: Analyzing the midpoint potential of ResA's cysteine residues (approximately -340 mV at pH 7) to confirm its ability to function as a reductant under physiological conditions .

  • Protein-protein interaction studies: Using pull-down assays, cross-linking, or surface plasmon resonance to demonstrate direct interaction between ResA and apocytochrome c.

These methodologies collectively provide strong evidence for ResA's specific role in the cytochrome c maturation pathway.

How does the three-dimensional structure of ResA relate to its substrate specificity?

The three-dimensional structure of ResA reveals a unique mechanism for substrate specificity that distinguishes it from other thiol-disulfide oxidoreductases. X-ray crystallography of the soluble domain of oxidized ResA at 1.4 Å resolution, complemented by NMR studies, has demonstrated that ResA undergoes significant redox-dependent conformational changes . Unlike many other thiol-disulfide oxidoreductases that are relatively nonspecific, ResA exhibits specificity for cytochrome c550 .

The structural basis for this specificity involves a surface cavity that is present only in the reduced state of ResA. This cavity serves as a recognition site for the apocytochrome c substrate. NMR data indicates that ResA uses alternate conformations to recognize different redox partners, with the reduced state exhibiting structural features optimized for interaction with cytochrome c550 .

The active site cysteine residues in ResA are positioned optimally for interaction with the specific spacing and configuration of cysteine residues in the CXXCH motif of apocytochrome c. This structural complementarity likely explains why ResA shows higher reactivity toward peptides derived from cytochrome c550 compared to nonspecific substrates like oxidized glutathione .

What methodologies are most effective for designing experiments to express and purify recombinant ResA?

For optimal expression and purification of recombinant ResA, researchers should consider employing a Design of Experiments (DoE) approach rather than the traditional one-factor-at-a-time method. This systematic approach allows for examining multiple factors simultaneously and identifying important interactions between variables .

Table 1: Design of Experiments Approach for Recombinant ResA Expression

ParameterLow LevelMid LevelHigh LevelResponse Variable
Temperature (°C)162537Protein yield (mg/L)
IPTG concentration (mM)0.10.51.0Soluble fraction (%)
Media compositionMinimalDefinedRichProper folding (activity assay)
Induction time (hours)41224Membrane association
Host strainBL21(DE3)RosettaSHuffleRedox state integrity

The expression of recombinant ResA presents specific challenges due to its membrane association and the critical importance of maintaining the proper redox state of its active site cysteines. The following methodological approach is recommended:

  • Construct design: Express the soluble domain (excluding the transmembrane region) with an N-terminal His-tag for purification, or use the full-length protein with appropriate detergents for extraction.

  • Expression system selection: Use E. coli strains engineered for disulfide bond formation (such as SHuffle or Origami) to maintain the correct redox environment.

  • Expression conditions optimization: Implement a full factorial or response surface methodology design to identify optimal temperature, inducer concentration, and harvest time .

  • Purification strategy: Employ immobilized metal affinity chromatography followed by size exclusion chromatography under conditions that maintain the desired redox state.

  • Quality assessment: Verify proper folding using circular dichroism and confirm redox activity using thiol-disulfide exchange assays with defined substrates.

This methodological approach allows for systematic optimization while accounting for the complex interactions between experimental variables that impact the expression and functionality of recombinant ResA .

How can researchers analyze potential contradictions in ResA functional data across different experimental systems?

When analyzing contradictory data regarding ResA function across different experimental systems, researchers should implement a structured approach to data quality assessment. Contradictions in functional data often arise from differences in experimental conditions, biological contexts, or methodological variations .

A systematic approach for resolving contradictions in ResA functional data involves implementing the three-parameter (α, β, θ) notation proposed for contradiction pattern analysis:

  • α: Number of interdependent items/variables in the experimental system

  • β: Number of contradictory dependencies identified by domain experts

  • θ: Minimal number of Boolean rules required to assess these contradictions

Table 2: Framework for Analyzing Contradictions in ResA Functional Data

Contradiction TypeExample in ResA ResearchResolution Approach
Methodological (2,1,1)Different redox activity results from in vitro vs. in vivo assaysStandardize assay conditions and validate with multiple methods
Biological context (3,2,1)Varying phenotypes in different bacterial strains lacking ResAAccount for genetic background and compensatory mechanisms
Substrate specificity (4,3,2)Conflicting data on ResA substrate preferencesImplement controlled binding studies with standardized substrates
Structural interpretation (3,4,2)Different structural models proposing alternate mechanismsIntegrate multiple structural techniques (X-ray, NMR, cryo-EM)

When contradictions are identified, researchers should:

  • Determine the dimensionality of interdependencies (α) by mapping all variables that could influence the outcome.

  • Document specific contradictory observations (β) with precise descriptors of experimental conditions.

  • Develop the minimum set of logical rules (θ) needed to explain when each outcome occurs.

  • Test these rules systematically with controlled experiments designed to isolate specific variables.

For complex contradictions in ResA function data, implementing Boolean minimization techniques can reduce the number of experimental conditions that need to be tested to resolve contradictions . This approach enables researchers to handle the complexity of multidimensional interdependencies within datasets and develop a structured classification of contradictions that can be effectively addressed.

What techniques should be employed to study redox-dependent conformational changes in ResA?

ResA undergoes significant redox-dependent conformational changes that are critical to its function. To properly characterize these structural transitions, researchers should employ multiple complementary techniques:

  • X-ray Crystallography: Obtain high-resolution structures of both oxidized and reduced forms of ResA. The current 1.4 Å resolution structure of oxidized ResA provides valuable insights, but should be complemented with a structure of the reduced form to fully understand the conformational changes .

  • Solution NMR Spectroscopy: NMR is particularly valuable for identifying redox-dependent conformational changes in ResA, as demonstrated in previous studies . This technique can:

    • Track chemical shift perturbations upon reduction/oxidation

    • Analyze dynamics at different timescales

    • Identify regions involved in substrate recognition

    • Monitor conformational changes in real-time during redox transitions

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique provides information about protein dynamics and solvent accessibility changes between different redox states.

  • Molecular Dynamics Simulations: Computational modeling of conformational transitions between oxidized and reduced states can provide insights into the mechanism of structural changes.

  • FRET-based Conformational Sensors: Designing FRET pairs at strategic locations in the ResA structure can allow real-time monitoring of conformational changes in solution.

Table 3: Complementary Techniques for Studying ResA Conformational Changes

TechniqueInformation ProvidedAdvantagesLimitations
X-ray CrystallographyHigh-resolution static structuresAtomic-level detailStatic snapshots only
Solution NMRDynamic information, chemical environmentSolution conditions, dynamicsSize limitations
HDX-MSSolvent accessibility, regional dynamicsNo size limitation, solution-phaseLower resolution
MD SimulationsTransition pathways, energeticsAtomic-level dynamicsRequires validation
FRET SensorsReal-time conformational changesIn vivo application possibleLimited structural details

By integrating data from these complementary techniques, researchers can develop a comprehensive understanding of how redox-dependent conformational changes in ResA facilitate its specific interaction with apocytochrome c and enable its function in the cytochrome c maturation pathway.

How should researchers design experiments to assess the specificity of ResA for different substrates?

To rigorously assess ResA's substrate specificity, researchers should design experiments that directly compare its reactivity with cytochrome c-derived peptides versus non-specific substrates like oxidized glutathione . A comprehensive experimental design would include:

  • Substrate panel preparation: Generate a diverse panel of potential substrates including:

    • Synthetic peptides corresponding to the heme-binding motif of cytochrome c550

    • Variants with systematic mutations in the CXXCH motif

    • Peptides derived from other c-type cytochromes

    • Common thiol-disulfide oxidoreductase substrates (e.g., oxidized glutathione)

    • Control peptides with non-native cysteine arrangements

  • Kinetic analysis: Determine key enzyme kinetic parameters for each substrate:

    • Measure initial reaction rates at varying substrate concentrations

    • Calculate Km, kcat, and kcat/Km values to quantify binding affinity and catalytic efficiency

    • Plot Lineweaver-Burk or Eadie-Hofstee diagrams to identify potential binding mechanisms

  • Binding studies: Employ biophysical techniques to directly measure binding:

    • Isothermal titration calorimetry (ITC) to determine binding constants and thermodynamic parameters

    • Surface plasmon resonance (SPR) to measure on/off rates

    • Microscale thermophoresis (MST) to assess binding under near-native conditions

  • Structural analysis: Investigate the structural basis of specificity:

    • NMR chemical shift perturbation experiments to map binding interfaces

    • X-ray crystallography of ResA-substrate complexes

    • Cross-linking coupled with mass spectrometry to identify interaction sites

Table 4: Expected Outcomes for ResA Substrate Specificity Assessment

Substrate TypeExpected KmExpected kcatStructural Determinants
Cytochrome c550 peptideLow (µM range)HighSurface cavity in reduced ResA
Mutated CXXCH motifsVariableReducedDepends on conservation of key residues
Other c-type cytochromesModerateModeratePartial structural complementarity
Oxidized glutathioneHighLowLimited structural recognition
Control peptidesVery highVery lowNo specific recognition

This comprehensive approach will provide quantitative measures of ResA's substrate preference and elucidate the structural basis for its specificity toward cytochrome c550 .

What research methodology is most appropriate for investigating the in vivo function of ResA in Bacillus subtilis?

Investigating the in vivo function of ResA in B. subtilis requires a multifaceted research methodology that combines genetic, biochemical, and systems biology approaches . The following research methodology is recommended:

  • Genetic manipulation approaches:

    • Generate a clean, marker-less deletion of the resA gene using CRISPR-Cas9 or traditional homologous recombination

    • Create point mutations targeting the active site cysteines (C74S, C77S)

    • Develop conditional expression systems (e.g., xylose-inducible promoter) to titrate ResA levels

    • Construct fluorescent protein fusions for localization studies

  • Phenotypic characterization:

    • Assess growth under different respiratory conditions (aerobic, microaerobic, anaerobic)

    • Measure cytochrome c content using spectroscopic methods

    • Evaluate sensitivity to oxidative stress conditions

    • Analyze membrane potential and respiratory capacity

  • Biochemical validation:

    • Perform in vivo thiol trapping to assess the redox state of apocytochrome c

    • Use immunoprecipitation to identify ResA interaction partners

    • Implement proteomics approaches to characterize the impact on the cellular redox network

    • Measure enzymatic activities of cytochrome c-dependent processes

  • Systems biology integration:

    • Conduct transcriptomics analysis to identify compensatory responses

    • Perform metabolomics to assess the impact on cellular energy metabolism

    • Develop mathematical models of the cytochrome c maturation process

    • Apply flux balance analysis to predict metabolic consequences

When designing this methodology, researchers should incorporate appropriate controls including complementation with wild-type ResA, comparison with strains deficient in other cytochrome c maturation factors (e.g., CcdA), and validation across multiple growth conditions .

This comprehensive research methodology allows for systematic investigation of ResA function in its native cellular context while addressing potential redundancy or compensatory mechanisms that might obscure its precise role.

How can researchers integrate structural and functional data to develop a comprehensive model of ResA action?

Integrating structural and functional data for ResA requires a systematic approach that connects atomic-level details with biological function. The following methodology provides a framework for developing a comprehensive model of ResA action:

  • Structure-function correlation analysis:

    • Map functional data (enzyme kinetics, substrate specificity) onto the 3D structure

    • Identify structural elements that change upon redox transitions

    • Correlate conservation of residues with functional importance

    • Generate structure-based hypotheses for testing

  • Predictive modeling approach:

    • Develop a mechanistic model describing the catalytic cycle

    • Include conformational changes identified by NMR and crystallography

    • Incorporate substrate binding based on interaction studies

    • Simulate redox transitions and their effects on protein structure

  • Experimental validation cycle:

    • Design structure-guided mutations to test specific aspects of the model

    • Assess effects on both structure (using biophysical methods) and function (using activity assays)

    • Refine the model based on experimental outcomes

    • Iterate through multiple rounds of prediction and validation

  • Integration with cellular context:

    • Connect structural mechanisms to in vivo phenotypes

    • Determine how membrane association influences function

    • Account for interactions with other components of the cytochrome c maturation system

    • Consider the impact of cellular redox environment on ResA activity

This integrated approach allows researchers to build a comprehensive model that explains how ResA's structure enables its specific function in reducing apocytochrome c, and how this function contributes to the broader process of cytochrome c maturation in B. subtilis .

What statistical approaches are most appropriate for analyzing contradictory data in ResA research?

When analyzing contradictory data in ResA research, appropriate statistical approaches should be employed to distinguish genuine biological effects from experimental artifacts and identify underlying patterns . The following statistical methodology is recommended:

  • Meta-analysis framework:

    • Systematically collect all available data on ResA function

    • Apply fixed or random effects models depending on heterogeneity

    • Calculate effect sizes and confidence intervals

    • Perform sensitivity analyses to identify influential studies

  • Multivariate analysis techniques:

    • Implement principal component analysis (PCA) to identify major sources of variation

    • Use partial least squares discrimination analysis (PLS-DA) to separate experimental conditions

    • Apply hierarchical clustering to identify patterns in contradictory results

    • Employ ANOVA with post-hoc tests to identify significant factors

  • Bayesian approaches for contradiction resolution:

    • Develop Bayesian network models representing causal relationships

    • Update prior beliefs with new experimental evidence

    • Calculate posterior probabilities for competing hypotheses

    • Identify the most probable explanation for contradictory observations

  • Boolean rule minimization:

    • Represent contradictions using the (α, β, θ) notation system

    • Apply Boolean minimization algorithms to reduce complex rule sets

    • Develop the minimum set of logical rules explaining experimental outcomes

    • Use these rules to design decisive experiments

Table 5: Statistical Framework for Analyzing Contradictions in ResA Research

Analysis LevelStatistical ApproachApplication to ResA Research
Data QualityOutlier detection, normality testingIdentify problematic datasets or measurements
Data IntegrationMeta-analysis, standardizationCombine results from different experimental systems
Pattern RecognitionPCA, clustering, factor analysisIdentify conditions leading to different outcomes
Hypothesis TestingBayesian inference, contradiction pattern analysisDetermine most likely explanation for contradictions
Experimental DesignPower analysis, optimal designDesign definitive experiments to resolve contradictions

By applying these statistical approaches, researchers can systematically address contradictions in ResA research, identify their underlying causes, and design targeted experiments to resolve remaining uncertainties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.