Recombinant Bacillus subtilis Type 4 prepilin-like proteins leader peptide-processing enzyme (comC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
comC; BSU28070; Prepilin leader peptidase/N-methyltransferase; Late competence protein ComC [Includes: Leader peptidase; Prepilin peptidase; N-methyltransferase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
comC
Target Protein Sequence
MLSILFIFGLILGSFYYTAGCRIPLHLSIIAPRSSCPFCRRTLTPAELIPILSFLFQKGK CKSCGHRISFMYPAAELVTACLFAAAGIRFGISLELFPAVVFISLLIIVAVTDIHFMLIP NRILIFFLPFLAAARLISPLDSWYAGLLGAAAGFLFLAVIAAITHGGVGGGDIKLFAVIG FVLGVKMLAAAFFFSVLIGALYGAAAVLTGRLAKRQPLPFAPAIAAGSILAYLYGDSIIS FYIKMALG
Uniprot No.

Target Background

Function
This enzyme plays a crucial role in type II pseudopili formation. It proteolytically removes the leader sequence from substrate proteins and subsequently monomethylates the α-amino group of the newly exposed N-terminal phenylalanine. Its substrates include proteins essential for the biogenesis of the type II general secretory apparatus.
Database Links
Protein Families
Peptidase A24 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ComC and what is its function in Bacillus subtilis?

ComC is a prepilin signal peptidase (SPase) in Bacillus subtilis that specifically cleaves type IV prepilin signal peptides. It's an essential component of the competence system, which enables B. subtilis to take up DNA from the environment. ComC processes prepilin-like proteins by cleaving their signal peptides at the cytoplasmic side of the membrane . After processing, these proteins become integral components of the DNA uptake machinery. Unlike most signal peptidases, the hydrophobic H-domain remains attached to the mature protein after cleavage by ComC .

How are Type 4 prepilin-like proteins processed in B. subtilis?

Type 4 prepilin-like proteins in B. subtilis possess a distinctive signal peptide structure compared to typical secretory proteins. These signal peptides contain:

  • An N-domain with positively charged amino acids

  • A "C-domain" containing the ComC cleavage site (positioned between the N and H domains)

  • An H-domain (hydrophobic region)

Processing occurs at the cytoplasmic side of the membrane, where ComC cleaves the prepilin at a specific site . The unique feature of this processing is that the hydrophobic H-domain remains attached to the mature protein after cleavage, which is critical for the function of these proteins in the competence apparatus .

What experimental methods are used to study ComC-processed proteins?

Several experimental techniques can be employed to study ComC-processed proteins:

  • SDS-PAGE Analysis: A standardized protocol involves:

    • Culturing B. subtilis strains to mid-log growth phase (OD 600 of 0.8-1.0)

    • Collecting aliquots equivalent to an OD 600 of 2.4

    • Centrifuging at 13,000 g for 5 minutes to harvest cells

    • Resuspending cells in lysis buffer containing lysozyme

    • Mixing with sample loading buffer and centrifuging

    • Loading appropriate volumes of sample supernatant onto polyacrylamide gels

    • Performing electrophoresis, staining, destaining, and densitometric analysis

  • Western Blot Analysis: Can be used to monitor ComS accumulation, which peaks between T3 and T4, mirroring the pattern of competence development .

  • Co-immunoprecipitation: Effective for studying protein interactions, such as those between ComS and MecA, which could indirectly affect ComC function in the competence system .

How does ComC integrate with the broader competence development pathway?

ComC functions within a complex regulatory network controlling competence development in B. subtilis:

  • Competence Regulation: ComK is the master transcriptional regulator required for expressing genes involved in DNA uptake. In log-phase cultures, ComK is trapped in a complex with MecA and ClpC, rendering it inactive .

  • Activation Mechanism: The ComS protein, encoded within the srf operon, is induced in response to high cell density and nutritional stress. ComS binds to MecA, releasing active ComK from the complex .

  • Temporal Coordination: Western analysis shows that ComS accumulates to maximal levels between T3 and T4, which directly correlates with competence development and late competence gene expression .

  • ComC's Role: While ComC processes the prepilin-like proteins required for DNA uptake machinery, its activity is temporally coordinated with ComK activation to ensure proper assembly of the competence apparatus .

The regulatory interactions can be summarized in the following table:

ComponentFunctionRegulationTiming in Competence
ComKTranscription factorTrapped by MecA-ClpC complexLate stages after release
MecAAdaptor proteinBinds ComK and ComSPresent throughout
ClpCAAA+ ATPaseForms complex with MecA and ComKPresent throughout
ComSReleases ComKInduced by quorum sensingPeaks between T3-T4
ComCProcesses prepilinsRegulated by ComKAfter ComK activation

What computational approaches can predict potential ComC substrates?

Advanced computational methods can be used to predict potential ComC substrates with high accuracy:

  • Protein Language Models: Models like ESM-1v and CARP-640M show significant predictive power for protein function and can be adapted to identify ComC cleavage sites .

  • Structure Prediction Tools: AlphaFold2 residue confidence scores (pLDDT) demonstrate predictive value for protein activity, with an AUC-ROC of 0.77 for certain enzyme families, and could be applied to ComC substrate prediction .

  • Inverse Folding Metrics: Tools like ProteinMPNN have shown substantial predictive power (AUC-ROC of 0.75) in assessing protein activity and could be valuable for evaluating potential ComC substrates .

The following table summarizes metric performance that could be adapted for ComC substrate prediction:

These metrics could be combined into a computational pipeline to prioritize potential ComC substrates for experimental validation .

How should researchers optimize expression and purification of recombinant ComC?

Expressing and purifying membrane proteins like ComC presents unique challenges. Based on established protocols for similar proteins, the following methodological approach is recommended:

  • Sample Preparation Strategy:

    • Culture B. subtilis strains in LB medium to mid-log growth phase (OD 600 of 0.8-1.0)

    • Collect aliquots equivalent to an OD 600 of 2.4

    • Harvest cells by centrifugation at 13,000 g for 5 minutes

    • Carefully resuspend in lysis buffer containing lysozyme

    • For membrane proteins like ComC, add appropriate detergents (e.g., DDM, LDAO)

  • Expression System Selection:

    • For high-yield: E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane proteins

    • For native processing: A ComC-deficient B. subtilis strain with an inducible expression system

  • Expression Conditions Optimization:

    • Reduce temperature after induction (16-20°C)

    • Use lower inducer concentrations

    • Consider specialized media formulations with membrane-stabilizing agents

  • Purification Strategy:

    • Solubilization with mild detergents (1-2× CMC)

    • Affinity chromatography (IMAC) followed by size exclusion

    • Maintain detergent throughout purification

For SDS-PAGE analysis of purified ComC and its substrates, follow the protocol outlined in the research literature, with special attention to sample preparation steps that vary across B. subtilis-related studies .

What experimental approaches can validate predicted ComC substrates?

A comprehensive validation strategy combines computational prediction with experimental verification:

  • In Silico Screening Pipeline:

    • Apply protein language models (ESM-1v) to scan proteome for potential substrates

    • Filter candidates based on AlphaFold2 structural predictions

    • Prioritize candidates using ProteinMPNN scores

  • Recombinant Expression and In Vitro Processing:

    • Express and purify candidate substrates

    • Incubate with purified ComC

    • Analyze processing by SDS-PAGE and mass spectrometry

    • Follow the standardized B. subtilis sample preparation protocol for consistent results

  • In Vivo Validation:

    • Generate fusion constructs with reporter proteins

    • Express in both wild-type and ComC-deficient B. subtilis

    • Analyze processing through phenotypic assays

  • Site-Directed Mutagenesis:

    • Introduce mutations at predicted cleavage sites

    • Assess impact on processing efficiency

    • Correlate with functional outcomes

Combining computational filters has been shown to improve experimental success rates by 50-150% in related enzyme systems, suggesting a similar approach would be valuable for ComC substrate validation .

How does the ComS-MecA interaction pathway relate to ComC function?

While ComC processes prepilin-like proteins, the ComS-MecA interaction plays a critical regulatory role in competence development:

  • Experimental Evidence: Western analysis and coimmunoprecipitation studies demonstrate that ComS binds to MecA, which is further supported by in vitro experiments .

  • Mechanistic Connection: ComS binding to MecA releases ComK from the MecA-ClpC complex, allowing ComK to stimulate transcription of its own gene and late competence operons .

  • Temporal Correlation: ComS accumulation peaks between T3 and T4, mirroring the pattern of competence development and late competence gene expression .

  • Functional Relationship to ComC: While ComC doesn't directly interact with ComS or MecA, the timing of ComS-mediated ComK release coordinates with ComC activity to ensure proper assembly of the DNA uptake apparatus .

This regulatory cascade represents a sophisticated mechanism for integrating environmental signals (cell density and nutritional status) with the developmental program of competence, ultimately leading to the ComC-dependent processing of prepilin-like proteins required for DNA uptake .

What precautions should be taken when analyzing ComC-processed proteins by SDS-PAGE?

When analyzing ComC-processed proteins, researchers should follow these methodological guidelines:

  • Standardized Sample Collection:

    • Culture B. subtilis to a consistent growth phase (OD 600 of 0.8-1.0)

    • Collect standardized amounts of cells (equivalent to OD 600 of 2.4)

    • Process samples promptly to prevent degradation

  • Sample Preparation Consistency:

    • Use standardized lysis buffer with appropriate lysozyme concentration

    • Ensure complete solubilization before loading

    • For membrane proteins like ComC or its substrates, include appropriate detergents

  • SDS-PAGE Conditions:

    • Select appropriate acrylamide percentage based on target protein size

    • Maintain consistent running conditions

    • Include appropriate molecular weight markers

  • Analysis Considerations:

    • Use densitometry software for quantitative analysis

    • Include appropriate controls (wild-type, ComC-deficient strains)

    • When comparing results across experiments, maintain consistent protocol parameters

Failure to standardize these procedures has led to inconsistencies across B. subtilis-related studies, making it difficult to compare findings between different research groups .

How can computational scoring methods be adapted for ComC and substrate engineering?

Advanced computational methods can guide both ComC enzyme engineering and substrate prediction:

  • Sequence-Based Scoring:

    • Protein language models like ESM-1v (AUC-ROC 0.68) effectively assess sequence quality

    • CARP-640M shows similar performance to ESM-1v across diverse enzyme families

  • Structure-Based Assessment:

    • AlphaFold2 pLDDT scores (AUC-ROC 0.66) correlate with protein activity

    • Inverse folding metrics such as ProteinMPNN (AUC-ROC 0.75) and ESM-IF (AUC-ROC 0.70) show high predictive power

  • Energy Function Evaluation:

    • Rosetta-relax energy calculations (AUC-ROC 0.76) provide valuable structural insights

    • Metrics from structure prediction can assess stability of enzyme-substrate complexes

By combining these computational approaches into a composite scoring system (COMPSS), researchers achieved 77% higher success rates in related enzyme systems compared to sequences failing these filters . This integrated approach could be adapted specifically for ComC and its substrates, with an emphasis on metrics showing highest predictive power.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.