Recombinant Bacillus subtilis Uncharacterized ABC transporter ATP-binding protein YfiC (yfiC)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

Gene Identification:

  • Gene ID: BSU08220 (Bacillus subtilis subtilis 168) .

  • Length: 1,815 base pairs (604 amino acids) .

  • Location: Plasma membrane .

  • UniProt Entry: P54719 (Swiss-Prot reviewed) .

AttributeValueSource
Gene NameyfiC
Protein Length604 amino acids
Expression HostsE. coli, Yeast, Baculovirus, Mammalian

Key Features:

  • Belongs to the ABC transporter superfamily, which utilizes ATP hydrolysis to drive substrate transport across membranes .

  • Contains conserved NBD motifs, including Walker A/B sequences and the ABC signature motif .

  • Classified as an "uncharacterized" transporter due to limited experimental data on substrate specificity or regulatory mechanisms .

Expression Systems and Production

Recombinant YfiC is produced via heterologous expression in diverse hosts, with varying yields and post-translational modification capabilities .

Host SystemAdvantagesChallenges
E. coliHigh yield, rapid turnaroundLimited post-translational modifications
YeastImproved folding for eukaryotic proteinsModerate yield
Baculovirus (Insect Cells)Native-like modifications (e.g., phosphorylation)Higher cost, complex handling
Mammalian CellsAuthentic post-translational processingLow yield, lengthy protocols

Purification and Yield:

  • Typical yields range from 1 mg per production run, depending on host efficiency .

  • Mammalian systems are preferred for functional studies requiring proper protein folding .

Potential Functional Roles

Though uncharacterized, YfiC’s role can be hypothesized based on ABC transporter functions in Bacillus subtilis:

  1. Drug Resistance: Overexpression of exporters may confer resistance to antibiotics or toxic metabolites .

  2. Ion/Peptide Transport: Homologs like ABCB6 (iron transport) and ABCB11 (bile salt transport) suggest roles in metal or organic anion translocation .

  3. Regulatory Functions: Some ABC ATPases modulate translation elongation or stress responses .

Regulatory and Functional Context

  • Zinc Homeostasis: While YfiC is not directly linked to Zur-regulated genes (e.g., yciC) , ABC transporters in Bacillus subtilis often interact with metallochaperones or stress-response systems .

  • Genetic Neighborhood: YfiC is not part of a known operon, suggesting it may function as a standalone ATPase or pair with orphan TMDs .

Research Gaps and Opportunities

  • Functional Characterization: No experimental data on substrate binding or transport activity.

  • Structural Validation: AlphaFold predictions require confirmation via X-ray crystallography or cryo-EM .

  • Regulatory Mechanisms: Potential interactions with transcription factors like Zur remain unexplored .

Applications in Biotechnology

  • Therapeutic Targets: ABC transporters are key targets for antibiotic resistance inhibitors. YfiC could serve as a model for developing broad-spectrum inhibitors .

  • Bioproduction: Recombinant YfiC may assist in studying ATP-dependent transport mechanisms in bacterial membrane systems .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can serve as a reference for your own preparations.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the product with the specified tag.
Synonyms
yfiC; BSU08220; Uncharacterized ABC transporter ATP-binding protein YfiC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-604
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yfiC
Target Protein Sequence
MLKDIRKPFQYPKLPIDKKEGAKKRAKAKDTKGTLRRIWSYLAERKGLLILVMLMVVISA IFGLLGPFVIGKAIDHFIVGKTVSGLIPVLLLLLAIYIIQSLSLWFQNYWMITISQGTVF RMRSELFTHLHELPIPFFDKQRHGELMSRVTNDIENVSSTLNTSVIQILSSVITFVGTIA VMLYMSPLLTLITLTIIPVMAASLKWITNRTGKLFKEQQKNLGDLNGYIEESVSGAKVIK AYSREKQITAEFLEKNAALKTSGFWAQTISGFIPKVMNSLNNLSFTMIAAIGGLFALKGW ISIGSIVVFAEYSRQFTRPLNDLANQFNTMLSAIAGAERVFDVLDEKEEREDEKNAVHQP IQTGSIEFRDVSFGYDKGQQTLKHLQFTVPAGQSIAFVGPTGAGKTTVTNLLARFYEPND GKILIDGTDIKTLTRASLRKNMGFVLQDSFLFQGTIRENIRYGRLDASDQEVEAAAKTAN AHSFIERLPKGYDTVLTQNGSGISQGQKQLISIARAVLADPVLLILDEATSNIDTVTEVN IQEALARLMEGRTSVIIAHRLNTIQRADQIVVLKNGEMIEKGSHDELIRQKGFYSDLYES QFEK
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YfiC and how is it classified within ABC transporters?

YfiC is an ATP-binding protein component of an uncharacterized ABC transporter in Bacillus subtilis. Similar to other ABC transporters, it likely consists of a nucleotide-binding domain (NBD) that hydrolyzes ATP to energize substrate transport. ABC transporters generally contain two transmembrane domains (TMDs) and two NBDs, with the latter containing conserved motifs including Walker A, Walker B, and signature motifs. Based on structural similarities to characterized ABC transporters like BmrA (YvcC) in B. subtilis, YfiC likely functions as part of a homodimeric or heterodimeric transporter complex .

How does YfiC gene expression compare to other ABC transporters in B. subtilis?

Unlike some characterized B. subtilis ABC transporters such as BmrA (YvcC), which is constitutively expressed throughout bacterial growth , the expression pattern of YfiC remains largely uncharacterized. Expression analysis would require techniques similar to those used for other B. subtilis genes, including reporter gene fusions, quantitative RT-PCR, or RNA-seq approaches. Based on patterns observed with other ABC transporters, YfiC expression might be regulated by specific environmental conditions or growth phases, although this requires experimental verification.

What experimental approaches can determine the genomic context of yfiC?

Understanding the genomic context of yfiC requires:

  • Genome sequence analysis to identify flanking genes and potential operonic structures

  • Transcriptional analysis using Northern blotting or RT-PCR to confirm co-transcription with adjacent genes

  • Promoter mapping using 5' RACE or primer extension

  • Analysis of transcription factor binding sites similar to the approach used for yciC, where Zur binding sites were identified

The identification of nearby genes may provide functional insights, as ABC transporter genes are often organized in operons with genes encoding cognate permeases or substrate-binding proteins.

What structural features are predicted for YfiC?

Based on characterized ABC transporters like the ATP-binding subunit from Geobacillus kaustophilus, YfiC likely contains:

  • An ATP-binding pocket with Walker A and B motifs

  • A signature LSGGQ motif characteristic of ABC transporter NBDs

  • A thick "L" shape structure with two arms similar to other bacterial ATP-binding subunits

  • Conserved catalytic residues for ATP hydrolysis

The precise structure would require X-ray crystallography or cryo-EM analysis, similar to the 1.77 Å resolution structure determined for the G. kaustophilus ATP-binding subunit .

How can researchers obtain high-resolution structural data for YfiC?

To determine YfiC structure:

  • Express recombinant YfiC with a purification tag (e.g., His6) using B. subtilis constitutive expression systems

  • Purify using affinity chromatography followed by size-exclusion chromatography

  • Assess protein homogeneity using dynamic light scattering

  • Screen crystallization conditions using vapor diffusion methods

  • Optimize crystal growth for X-ray diffraction studies

  • Alternatively, employ cryo-EM for structural determination if crystallization proves challenging

The structure could then be compared to known ABC transporter structures to identify unique features of YfiC.

What protein domains and motifs are expected in YfiC?

Based on characterized ABC transporters, YfiC likely contains:

Domain/MotifExpected Sequence FeaturesFunction
Walker A motifGXXGXGKS/TATP binding
Walker B motifXXXXD (where X is hydrophobic)ATP hydrolysis coordination
Signature motifLSGGQABC transporter identification
Q-loopContains conserved glutamineCoordinates Mg2+
D-loopContains conserved aspartateCoordinates with Walker A
H-loop/switchContains conserved histidinePositions water for ATP hydrolysis

These motifs would need to be experimentally verified through site-directed mutagenesis and functional assays similar to those conducted for BmrA .

What expression systems are optimal for recombinant YfiC production?

For YfiC expression, researchers should consider:

  • Homologous expression in B. subtilis using constitutive expression vectors derived from IPTG-inducible systems (with lacI gene deleted)

  • Heterologous expression in E. coli using lacIq strains for regulated expression by retaining lacOI and lacO3 operator sites

  • Codon optimization based on the favorable feature that "B. subtilis has no significant bias in codon usage"

The B. subtilis constitutive expression system has demonstrated yields of up to 13% of total cellular protein for other recombinant proteins , making it potentially suitable for YfiC production.

What purification strategies yield functional YfiC protein?

For purification of functional YfiC:

  • Add a hexahistidine tag to facilitate affinity purification

  • Use n-dodecyl β-D-maltoside or other mild detergents for membrane protein solubilization (if YfiC shows membrane association)

  • Employ one-step affinity chromatography using nickel or cobalt resins

  • Assess protein purity by SDS-PAGE and Western blotting

  • Verify protein functionality through ATPase activity assays

This approach parallels successful methods used for BmrA purification, which yielded highly pure and functional protein .

How can researchers assess YfiC functional integrity after purification?

To verify YfiC functionality:

  • Measure ATPase activity using colorimetric phosphate release assays

  • Assess nucleotide binding through fluorescence spectroscopy using fluorescent ATP analogs

  • Perform thermal shift assays to evaluate protein stability with and without ATP

  • Reconstitute purified YfiC into liposomes to evaluate ATP hydrolysis in a membrane environment

  • Examine ATP binding cooperativity using enzyme kinetics analysis, as BmrA showed positive cooperativity in ATP hydrolysis

Functional YfiC should demonstrate vanadate-sensitive ATPase activity similar to other ABC transporters.

What methodologies can identify potential YfiC substrates?

To determine YfiC substrates:

  • Generate yfiC knockout mutants and assess phenotypic changes in growth under different conditions

  • Perform transport assays using fluorescent substrates similar to those used for BmrA (Hoechst 33342, doxorubicin, 7-aminoactinomycin D)

  • Prepare inverted membrane vesicles enriched with overexpressed YfiC to measure substrate transport

  • Use fluorescence spectroscopy to detect binding of potential substrates

  • Employ isothermal titration calorimetry to quantify substrate binding affinities

These approaches parallel successful strategies used to characterize BmrA, which was confirmed as a multidrug ABC transporter in B. subtilis .

How can researchers investigate YfiC's role in metal homeostasis?

Given that some B. subtilis ABC transporters are involved in metal homeostasis (e.g., yciC in zinc homeostasis ), researchers should:

  • Assess yfiC expression changes in response to different metal concentrations

  • Look for metal-responsive regulatory elements in the yfiC promoter region

  • Measure intracellular metal content in wild-type versus ΔyfiC strains using ICP-MS

  • Perform metal binding assays with purified YfiC protein

  • Test growth of ΔyfiC mutants under metal limitation or excess conditions

The approach used to characterize the Zur-regulated yciC gene provides a methodological template .

What techniques can elucidate YfiC ATPase activity characteristics?

To characterize YfiC ATPase function:

  • Measure ATP hydrolysis rates using purified protein with a malachite green assay

  • Determine kinetic parameters (Km, Vmax) and substrate specificity

  • Investigate ATPase activity modulation by potential transport substrates

  • Assess cooperativity in ATP hydrolysis through Hill coefficient analysis

  • Examine vanadate sensitivity as a hallmark of ABC transporter ATPase activity

  • Reconstitute YfiC into liposomes to measure ATPase activity in a membrane-like environment

For context, reconstituted BmrA showed "the highest, vanadate-sensitive, ATPase activity reported so far for an ABC transporter" with positive cooperativity .

How might yfiC expression be regulated in B. subtilis?

Based on known regulatory mechanisms of other B. subtilis ABC transporters:

  • Look for potential binding sites of known transcriptional regulators (similar to Zur boxes found in the yciC regulatory region)

  • Perform chromatin immunoprecipitation (ChIP) to identify proteins binding to the yfiC promoter

  • Use reporter gene fusions to measure yfiC expression under different growth conditions

  • Analyze the effect of gene knockouts of potential regulatory proteins on yfiC expression

  • Examine expression patterns in different growth phases and stress conditions

The yciC gene provides an example of complex regulation with two functional Zur boxes: a primary site overlapping a σA promoter and a second site near the translational start point .

What computational approaches can predict yfiC function based on genomic context?

While acknowledging limitations of computational methods for functional prediction , researchers should:

  • Perform phylogenetic analysis of YfiC among Bacillus species

  • Analyze gene neighborhood conservation across related bacteria

  • Identify co-expressed genes through transcriptomic data mining

  • Use domain-based annotation tools while being cautious of paralog over-propagation mistakes

  • Apply protein structure prediction tools like AlphaFold to generate structural models for comparison with characterized ABC transporters

How does YfiC compare to characterized ABC transporters like BmrA in B. subtilis?

A comprehensive comparison requires:

  • Sequence alignment to identify conserved and divergent regions

  • Structural modeling to compare predicted fold patterns

  • Expression pattern analysis under identical growth conditions

  • Functional assays using identical substrates and conditions

  • Phenotypic analysis of respective gene knockouts

BmrA (YvcC) provides a valuable reference point as a well-characterized B. subtilis ABC transporter that functions as a multidrug transporter with ATP-dependent drug efflux .

What insights about YfiC can be derived from the ATP-binding subunit of Geobacillus kaustophilus?

The G. kaustophilus ATP-binding subunit structure at 1.77 Å resolution provides valuable insights:

  • The expected "L" shape with two thick arms characteristic of bacterial ATP-binding subunits

  • Location of the ATP-binding pocket near the end of arm I

  • Potential dimerization interface based on crystal structure

  • Comparison with similar structures from other bacteria (e.g., Salmonella typhimurium)

These structural features likely apply to YfiC given the conservation of ABC transporter nucleotide-binding domains across bacterial species.

How can researchers distinguish between in vitro and in vivo functions of YfiC?

To address the challenge that "in vitro activity alone is not sufficient to validate the function of protein in vivo" :

  • Combine biochemical characterization with genetic studies

  • Perform complementation assays with the ΔyfiC strain

  • Use site-directed mutagenesis to create variants with altered ATP binding/hydrolysis

  • Examine physiological phenotypes under relevant stress conditions

  • Follow Gene Ontology Consortium definitions to capture both molecular and biological functions

  • Consider enzyme promiscuity in vitro versus specific biological roles in vivo

This comprehensive approach addresses the scientific best practice that "best practices in functional annotations of enzymes strive to provide both in vitro (biochemical) and in vivo (genetic) evidence" .

What experimental strategies can validate computational predictions about YfiC function?

Given the limitations of computational predictions highlighted in recent research :

  • Design experiments to specifically test predicted functions

  • Use genetic knockouts combined with phenotypic assays under predicted relevant conditions

  • Perform substrate transport assays with predicted substrates

  • Express recombinant YfiC and test predicted biochemical activities

  • Consider the biological context and avoid paralog over-propagation mistakes

Researchers should remember that "for around a quarter of [computational] predictions, the same EC number was already present in the Uniprot annotation" , emphasizing the need for critical evaluation of computational results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.