Recombinant Bacillus subtilis Uncharacterized ABC transporter ATP-binding protein YknU (yknU)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yknU; BSU14320; Uncharacterized ABC transporter ATP-binding protein YknU
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yknU
Target Protein Sequence
METFKRLKMYYWPYRKVFMWSLLAMLLMTAITVVYPIILQITIDEIVLGRQYQLAAWVSL GFIAVMVLKGMATFFHQYLGDMFGIKSVYRLRNGLYEKLQRLSFSYYDNAKTGDLMSRLT ADVEGLRFFLSYGLAELIRFGLLVAISLSVMFYYSVPLTLVTIAVLPFLAVAVYRFDKRV HPAFRGIRKSFAKLNTKVQENISGINTVKSLSREDFQISTFNKANAEYRAQYLQTSSIWS AYFPLMEFIGNTCIVALLSYGGYLVMQNQLNPGELVAFFSLVNYMMWPIMNLGFVINMFS QAKASGERLLDILEKEEDITDHPHALHKQKLTGDVHFKNVSLAYGKEQTNALCNVSFEAN SGKVIGLLGPTGSGKSSVTQLLTRFYSPVGGMITIDHKPITDYSLKTLRSNIGVVLQESF LFSSTIRSNISYGRPDASMEDVIEAAKRAQAHNFIMELPDGYDTMLGERGMGLSGGQKQR IAIARAICLNPSILILDDATSAVDMQTEHSIQLALKEVMKNRTTFIVAHRISSLKHADEI LVFNKGRIRERGTHHELLEKGGYYKKIYDLQYRDVKMINEPHEVG
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bacillus subtilis Uncharacterized ABC Transporter ATP-binding Protein YknU (yknU)?

Recombinant Bacillus subtilis Uncharacterized ABC transporter ATP-binding protein YknU (yknU) is a protein produced through recombinant DNA technology that originates from the bacterium Bacillus subtilis. It belongs to the ATP-binding cassette (ABC) transporter family, specifically functioning as the ATP-binding component that powers substrate transport across cellular membranes. Despite being identified in the B. subtilis genome, its specific transport substrates and physiological roles remain uncharacterized, hence the "uncharacterized" designation in its name. The protein is available commercially for research purposes through suppliers such as MyBioSource.com .

What is the role of ABC transporters in Bacillus subtilis?

ABC transporters in Bacillus subtilis play crucial roles in the import and export of various substrates across the cell membrane, utilizing the energy from ATP hydrolysis to facilitate the movement of substrates against concentration gradients. These transport systems are involved in diverse cellular functions including:

  • Nutrient acquisition from the environment

  • Metal ion homeostasis, exemplified by the YcnJ copper importer

  • Export of toxins and antimicrobial compounds

  • Adaptation to environmental stresses such as high salinity

  • Maintenance of cell envelope integrity

The importance of these transporters is highlighted in their evolutionary conservation and their involvement in adaptation to environmental challenges, as demonstrated in experimental evolution studies of B. subtilis under high salinity stress .

How do ABC transporters function mechanistically in bacterial systems?

ABC transporters in bacterial systems like B. subtilis operate through a conserved mechanism involving distinct structural components:

  • The nucleotide-binding domain (NBD), like YknU, binds and hydrolyzes ATP

  • The transmembrane domain (TMD) forms the substrate translocation pathway

  • In import systems, a substrate-binding protein (SBP) initially captures the substrate

The transport cycle typically follows these steps:

  • ATP binding at the NBDs induces their dimerization

  • This dimerization triggers conformational changes in the TMDs

  • The TMDs alternate between inward-facing and outward-facing conformations

  • These conformational changes facilitate substrate movement across the membrane

This mechanism has been elucidated through structural studies of various ABC transporters, similar to how the copper-binding mechanism of YcnI was determined through crystallography and EPR spectroscopy .

What is the genomic context of yknU in Bacillus subtilis?

Although specific information about the genomic context of yknU is limited in the available data, analysis of similar systems in B. subtilis suggests important contextual considerations. Like the yrkPQR and yrkO divergon structure , yknU likely exists within a functional gene cluster that provides clues to its physiological role.

Similar to how the ycn operon comprises genes encoding three proteins (YcnJ, YcnK, and YcnI) that collectively function in copper homeostasis , yknU might be part of an operon containing genes encoding the transmembrane components of the transporter complex and possibly regulatory elements. This genomic organization would facilitate coordinated expression of functionally related components. Examination of the promoter region for transcription factor binding sites, similar to the YrkP-binding regions identified in the yrkO and yrkPQR promoters , could reveal regulatory mechanisms controlling yknU expression.

What experimental approaches are most effective for characterizing the function of YknU?

The characterization of an uncharacterized protein like YknU requires a multi-faceted experimental approach:

ApproachMethodologyExpected Outcome
Genetic AnalysisGene deletion and complementation studiesPhenotypic effects revealing physiological role
Expression ProfilingRT-qPCR, RNA-Seq under various conditionsRegulatory patterns and potential functional contexts
Biochemical CharacterizationATPase activity assays, substrate binding assaysEnzymatic parameters and substrate specificity
Structural StudiesX-ray crystallography, cryo-EM3D structure revealing binding sites and mechanism
Protein-Protein InteractionsCo-immunoprecipitation, bacterial two-hybridIdentification of partner proteins in the transport complex
Transport AssaysReconstituted systems in liposomesDirect measurement of transport function

These approaches are complementary and have been successfully employed in characterizing other bacterial transporters. For example, electron paramagnetic resonance and inductively coupled plasma-MS were used to determine that YcnI can bind a single Cu(II) ion, revealing its role in copper homeostasis .

How might the structure of YknU relate to its function?

As an ATP-binding protein, YknU likely contains several conserved structural motifs characteristic of ABC transporter nucleotide-binding domains:

MotifConsensus SequenceFunction
Walker AGXXGXGKS/TATP binding
Walker BhhhhDE (h=hydrophobic)ATP hydrolysis
Signature motif (C-loop)LSGGQSpecific to ABC transporters; important for NBD dimerization
Q-loopContains a conserved glutamineInteracts with the γ-phosphate of ATP and with the TMD
H-loopContains a conserved histidineParticipates in ATP hydrolysis
D-loopSALDInvolved in NBD-NBD interaction

The arrangement of these motifs creates a ATP-binding pocket that undergoes conformational changes during the ATP binding and hydrolysis cycle. These conformational changes are transmitted to the transmembrane domains, driving the transport process.

Similar to how the structure of YcnI revealed a unique copper-binding site featuring a monohistidine brace ligand set , structural studies of YknU might reveal unique features related to its specific substrate and function. High-resolution structural data combined with site-directed mutagenesis of key residues would provide valuable insights into the mechanism of action of this uncharacterized ABC transporter component.

What techniques can be used to identify potential substrates of the YknU-containing ABC transporter?

Identifying the substrates of uncharacterized transporters is a significant challenge that requires multiple complementary approaches:

  • Phenotypic screening of yknU deletion mutants on various substrates

  • Transcriptional response analysis to identify conditions that induce yknU expression

  • Transport assays with reconstituted systems testing candidate substrates

  • Metabolomic profiling comparing wild-type and yknU mutant strains

  • Binding assays using purified components and potential substrates

  • Comparative genomics to identify conserved gene neighborhoods that might suggest substrate specificity

  • Structural analysis and molecular docking to predict substrate binding sites

The integration of these approaches has proven successful in identifying substrates for other previously uncharacterized transporters. For example, bioinformatics analyses indicated that DUF1775 domains (like that in YcnI) frequently neighbor domains implicated in copper homeostasis, which led to the investigation and confirmation of copper binding by YcnI .

How do environmental conditions affect YknU expression and activity?

Understanding the regulation of YknU in response to environmental conditions can provide insights into its physiological role. While specific information about YknU regulation is not directly available, patterns observed in other B. subtilis transport systems suggest:

  • Metal ion concentrations may regulate expression if YknU is involved in metal transport, similar to the copper-dependent transcriptional repressor YcnK in the ycn operon

  • Stress conditions like high salinity might modulate expression, as B. subtilis adapts to different environmental stresses through modulation of transporter expression

  • Growth phase-dependent regulation might occur if the transported substrate is particularly important during specific growth phases

  • Transcriptional regulators, similar to YrkP which positively regulates the expression of several genes , likely control yknU expression

Experimental approaches to determine these regulatory patterns include:

  • Promoter-reporter fusions to monitor expression under various conditions

  • Chromatin immunoprecipitation to identify transcription factors binding to the yknU promoter

  • RNA-Seq analysis across multiple environmental conditions

  • Proteomic analysis to correlate transcript and protein levels

How can evolutionary analysis inform our understanding of YknU function?

Evolutionary analysis provides valuable context for understanding uncharacterized proteins like YknU:

  • Phylogenetic distribution across bacterial species can indicate the importance of the transporter in different ecological niches

  • Conservation patterns of specific residues can highlight functionally critical regions

  • Gene neighborhood conservation can suggest functional associations

  • Horizontal gene transfer events may reveal adaptation to specific environmental challenges

In the context of experimental evolution studies, B. subtilis has been shown to adapt to high salinity environments through the acquisition of foreign DNA from pre-adapted or naturally salt-tolerant species . Similar evolutionary processes might have shaped the functional specificity of YknU. Comparative analysis of YknU homologs across Bacillus species and related genera could reveal patterns of co-evolution with specific substrate utilization pathways, providing clues to its functional role.

What are the optimal protocols for purifying recombinant YknU protein for biochemical studies?

Purification of recombinant YknU for biochemical characterization requires careful optimization at each step:

  • Expression system selection:

    • E. coli BL21(DE3) for high-yield expression

    • B. subtilis for native-like expression environment

    • Insect cell systems for complex proteins requiring specific folding

  • Vector design considerations:

    • Affinity tag selection (His6, GST, MBP)

    • Tag position (N- or C-terminal) based on structural predictions

    • Inclusion of a protease cleavage site for tag removal

  • Optimization of expression conditions:

    • Temperature (typically lower temperatures favor proper folding)

    • Induction time and inducer concentration

    • Media composition and supplements (e.g., ATP or metal ions)

  • Purification strategy:

    • Affinity chromatography as the initial capture step

    • Ion exchange chromatography for intermediate purification

    • Size exclusion chromatography for final polishing and oligomeric state assessment

  • Quality control:

    • SDS-PAGE and Western blotting to assess purity

    • Mass spectrometry for identity confirmation

    • Dynamic light scattering for aggregation assessment

    • Circular dichroism for secondary structure verification

    • Functional assays (ATP binding and hydrolysis)

The inclusion of stabilizing agents such as ATP or non-hydrolyzable ATP analogs during purification is often critical for maintaining the native conformation of ABC transporter nucleotide-binding domains.

How can structural biology techniques be applied to study YknU?

Structural biology provides critical insights into the molecular mechanism of ABC transporters like YknU:

  • X-ray crystallography:

    • Has been successfully used to determine structures of other ABC transporter components, including both apo and copper-bound forms of YcnI

    • Requires highly pure, homogeneous, and stable protein preparations

    • May necessitate co-crystallization with ATP analogs or binding partners

  • Cryo-electron microscopy (cryo-EM):

    • Particularly valuable for larger complexes including transmembrane components

    • Does not require crystallization, which is often challenging for membrane proteins

    • Can capture different conformational states of the transport cycle

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Suitable for smaller domains and dynamic regions

    • Provides information about protein dynamics in solution

    • Useful for studying ligand binding interactions

  • Small-angle X-ray scattering (SAXS):

    • Provides low-resolution structural information in solution

    • Useful for studying conformational changes upon ATP binding

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps solvent accessibility and protein dynamics

    • Identifies regions involved in conformational changes during the transport cycle

  • Electron paramagnetic resonance (EPR) spectroscopy:

    • Used to study metal binding and protein dynamics

    • Successfully applied to characterize copper binding by YcnI

The integration of multiple structural techniques provides comprehensive insights into the structure-function relationship of ABC transporters like YknU.

What bioinformatics approaches can predict YknU function and structure?

Bioinformatics approaches offer powerful tools for predicting the function and structure of uncharacterized proteins like YknU:

  • Sequence analysis tools:

    • Multiple sequence alignment to identify conserved motifs

    • Hidden Markov Models to detect distant homologs

    • Analysis of conservation patterns to identify functionally important residues

  • Structural prediction methods:

    • AlphaFold2 and RoseTTAFold for accurate 3D structure prediction

    • Molecular dynamics simulations to study conformational dynamics

    • Docking simulations to predict potential substrates or interaction partners

  • Genomic context analysis:

    • Identification of operons and gene clusters containing yknU

    • Analysis of conserved gene neighborhoods across species

    • Similar to how the genomic context of ycnI provided insights into its role in copper homeostasis

  • Functional inference methods:

    • Gene Ontology term prediction

    • Pathway enrichment analysis

    • Protein-protein interaction network analysis

  • Evolutionary analysis:

    • Phylogenetic profiling to correlate with specific traits or environmental adaptations

    • Detection of selection pressure on specific residues

    • Analysis of horizontal gene transfer events

The integration of these computational approaches generates testable hypotheses about YknU function that can guide experimental investigations.

How can gene editing techniques be optimized for studying YknU in Bacillus subtilis?

Modern gene editing approaches provide powerful tools for investigating YknU function in its native context:

  • CRISPR-Cas9 system for B. subtilis:

    • Design of highly specific guide RNAs targeting yknU

    • Optimization of homology-directed repair templates for precise modifications

    • Strategies for scarless editing to avoid polar effects on adjacent genes

  • Site-directed mutagenesis approaches:

    • Targeting conserved motifs (Walker A, Walker B, signature motif)

    • Alanine scanning of predicted substrate-binding regions

    • Introduction of fluorescent protein fusions for localization studies

  • Conditional expression systems:

    • Inducible promoters for controlled expression

    • Degron tags for rapid protein depletion

    • Similar to the xylose-induced promoter controlling comK expression used in B. subtilis evolutionary studies

  • Reporter gene fusions:

    • Transcriptional fusions to monitor expression patterns

    • Translational fusions to assess protein levels and localization

    • Split reporter systems to study protein-protein interactions

  • Multiplexed genome editing:

    • Simultaneous modification of yknU and potential partner genes

    • Creation of strain libraries with various combinations of transporter component mutations

These approaches enable precise genetic manipulation to investigate the function of YknU and its interaction partners in vivo.

What are the challenges and solutions in reconstituting functional ABC transporters in vitro?

Reconstituting functional ABC transporters for in vitro studies presents several challenges and corresponding solutions:

ChallengeSolution
Obtaining all components in active formCo-expression systems; optimized purification protocols preserving native interactions
Maintaining native membrane environmentReconstitution into liposomes with lipid compositions mimicking B. subtilis membranes
Measuring transport activityDevelopment of sensitive fluorescent or radioactive substrate assays
Capturing different conformational statesUse of ATP analogs and transition state mimics
Protein instabilityAddition of stabilizing agents; nanodiscs or styrene-maleic acid lipid particles (SMALPs) for membrane protein stabilization
Identifying the correct substrateHigh-throughput screening of candidate substrates; metabolomic approaches

Successful reconstitution enables detailed mechanistic studies, including:

  • Determination of transport kinetics and substrate specificity

  • Investigation of the role of ATP binding and hydrolysis

  • Identification of inhibitors or modulators of transport activity

  • Correlation of structural changes with functional states

These in vitro approaches complement genetic and cellular studies to provide a comprehensive understanding of ABC transporter function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.