Recombinant Bacillus subtilis Uncharacterized ABC transporter ATP-binding protein YknV (yknV)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Potential Roles

Despite being labeled as "uncharacterized," structural and comparative analyses provide valuable clues about the potential functions of YknV in Bacillus subtilis. As a member of the ABC transporter family, YknV likely participates in the ATP-dependent transport of specific substrates across the bacterial cell membrane . The presence of both transmembrane and nucleotide-binding domains supports this hypothesis.

It's worth noting that Bacillus subtilis has emerged as a preferred chassis organism for synthetic biology applications and the production of high-value compounds . The characterization of membrane transporters like YknV could potentially contribute to enhancing the productivity and versatility of B. subtilis as a microbial cell factory. Membrane transporters often represent rate-limiting factors in biotechnological processes, particularly when the import of substrates or export of products is involved.

Comparison with Related Proteins

While YknV itself remains functionally uncharacterized, insights can be gained by examining related proteins. The search results suggest some potential functional overlap with YkuV, a thiol:disulfide oxidoreductase that responds to environmental oxidative stress in B. subtilis . YkuV has been experimentally characterized as having a low midpoint redox potential and the ability to reduce various protein substrates, functioning as a general thiol:disulfide oxidoreductase . Whether YknV shares any of these functional characteristics or interacts with YkuV in stress response pathways remains to be determined.

Table 2: Domain Organization of YknV

DomainPosition (amino acids)Predicted FunctionSource
ABC transmembrane type-1 domain45-329Substrate recognition and transport across membraneSubtiWiki
ABC transporter domain363-597ATP binding and hydrolysisSubtiWiki
Membrane-spanning regionN-terminal regionMembrane anchoring and substrate translocationInferred from sequence
ATP-binding cassetteC-terminal regionEnergy coupling for transportInferred from sequence

Recombinant Production and Purification

The recombinant production of YknV represents a significant advancement in studying this uncharacterized protein. According to the available information, full-length YknV has been successfully expressed in Escherichia coli as a recombinant protein fused to an N-terminal histidine tag (His-tag) . This approach facilitates protein purification through affinity chromatography and subsequent structural and functional analyses.

The commercial availability of recombinant YknV (e.g., catalog number RFL194BF) suggests standardized production protocols have been established . According to the product information, the recombinant protein is typically supplied as a lyophilized powder, which can be reconstituted in appropriate buffers for experimental use. Storage recommendations include maintaining the protein at -20°C/-80°C and avoiding repeated freeze-thaw cycles .

Expression Systems and Optimization

While E. coli represents the most common heterologous expression system for YknV, recent advances in B. subtilis expression systems could potentially offer advantages for the production of native B. subtilis proteins. Recent research has demonstrated the efficacy of the LuxRI quorum sensing (QS) system from Aliivibrio fischeri for achieving coordinated protein overproduction in B. subtilis . This system enables cell-density-dependent expression that naturally coordinates with cell growth, potentially overcoming limitations associated with constitutive or chemically induced expression systems .

The LuxRI QS system has been shown to surpass commonly used promoter-based systems in B. subtilis, including P43 and PylbP, making it a promising platform for recombinant protein overproduction . While not specifically tested with YknV, this expression system could theoretically be adapted for the efficient production of membrane proteins like YknV in their native host.

Table 3: Recombinant YknV Production Parameters

ParameterDescriptionSource
Expression HostEscherichia coliCreative Biomart
TagN-terminal His tagCreative Biomart
Protein LengthFull Length (1-604)Creative Biomart
FormLyophilized powderCreative Biomart
Storage-20°C/-80°C, avoid freeze-thaw cyclesCreative Biomart
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Creative Biomart
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0Creative Biomart

Research Applications and Future Directions

The availability of recombinant YknV opens several avenues for research into this uncharacterized ABC transporter. Potential research applications include:

Functional Characterization

Substrate identification represents a critical step in characterizing YknV. Transport assays using reconstituted liposomes or whole-cell systems could help identify the natural substrates of this transporter. Additionally, gene knockout or knockdown studies in B. subtilis could reveal phenotypic changes associated with YknV deficiency, providing clues about its physiological role.

Biotechnological Applications

As B. subtilis continues to gain prominence as a microbial cell factory in synthetic biology applications , characterizing and potentially engineering YknV could contribute to enhancing the productivity of this chassis organism. If YknV is involved in the export of specific compounds or the import of precursors, its optimization could improve the efficiency of biotechnological processes.

Knowledge Gaps and Research Opportunities

Several key questions about YknV remain unanswered and represent opportunities for future research:

  1. What are the natural substrates of YknV in B. subtilis?

  2. How is the expression of YknV regulated in response to environmental conditions?

  3. Does YknV interact with other membrane proteins or cellular components?

  4. What is the three-dimensional structure of YknV, and how does it facilitate substrate transport?

  5. Can YknV be engineered to transport specific molecules of biotechnological interest?

Addressing these questions would significantly advance our understanding of this uncharacterized ABC transporter and potentially reveal new applications in biotechnology and synthetic biology.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yknV; BSU14330; Uncharacterized ABC transporter ATP-binding protein YknV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-604
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yknV
Target Protein Sequence
MKQAKKQGVLERFYYSSDEIIEKPFNWAQMWRLLSYVKPYRKTILPLSFLTVLIGTAVKL VIPILIGVYVLDQAITGRNSELLIQLIFIISGLYVLNYAANVLRIRWMNQLGQHVIYDLR QHLFTHVQRLSHRFFDQRSAGSILVRIMNDINSLQELFTSGVINLLTDLLLLAGVIIILF TLSPELTIAIMVTLPIMFFISTSLRKKIRRSWQTVRLKQSKLNSHLNESIQGIRVTQAFT QEEENMAYFDGVNQENYESWREATRKNAMFRPLVEMTNAIGTAVLIWYGATLIMNETITI GVFVSFAFYLGMFWEPISRLGQVYNQLLMGMASSERIFEFLDEQPNVKEKPNAIHNEKIN GEISFEEVEFSYDEKRKALHAVSFSIPAGSTLALVGHTGSGKTTIANLISRFYDAAGGTI KIDGIPIKDLSLASLRSQISIVLQDTFIFSGTIMENIRFGRPNASDEEVMKASQAVGADE FISDLAEGYATEVEERGSVLSAGQRQLISFARALLADPAIIILDEATASIDTETEVKIQQ ALKTLLKGRTAVMIAHRLSTIRDADRIIVLDHGRKIEEGNHDQLLAKGGIYAGLVKAQYS TAIE
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of the YknV protein?

YknV is a full-length (604 amino acid) ATP-binding protein that functions as part of an ABC transporter system in Bacillus subtilis. The protein contains characteristic motifs of ABC transporters including the P-loop (Walker A), Walker B, and ABC signature motifs that are crucial for ATP binding and hydrolysis . The protein sequence includes transmembrane regions and nucleotide-binding domains (NBDs) typical of ABC transporters. The complete amino acid sequence is available and includes multiple transmembrane segments and cytoplasmic domains responsible for ATP binding and hydrolysis .

How can YknV protein be expressed for laboratory studies?

Recombinant YknV protein can be successfully expressed in E. coli expression systems with an N-terminal His tag to facilitate purification . The protein is typically provided as a lyophilized powder which should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add 5-50% glycerol (final concentration) and aliquot for storage at -20°C/-80°C to avoid repeated freeze-thaw cycles that can damage protein integrity . The purity can be confirmed via SDS-PAGE analysis, with research-grade preparations typically exceeding 90% purity .

What are the predicted functional characteristics of YknV based on sequence homology?

As an ABC transporter ATP-binding protein, YknV likely participates in the active transport of substrates across the cellular membrane using energy derived from ATP hydrolysis . Based on the mechanistic understanding of ABC transporters, YknV probably undergoes significant conformational changes upon ATP binding and hydrolysis, cycling between inward-facing (IF) and outward-facing (OF) states . The specific substrates transported by the YknV system remain uncharacterized, but the protein architecture suggests it functions similarly to other bacterial ABC transporters involved in nutrient uptake or toxin export .

What are the optimal conditions for conducting in vitro ATP hydrolysis assays with purified YknV?

For optimal ATP hydrolysis activity assays with YknV, researchers should:

  • Reconstitute the lyophilized protein in a suitable buffer (typically Tris/PBS-based, pH 8.0)

  • Include essential co-factors:

    • Mg²⁺ ions (typically 5-10 mM) as they are critical for ATP binding and hydrolysis

    • ATP substrate (usually 0.5-5 mM range)

  • Monitor ATPase activity using:

    • Colorimetric assays detecting released inorganic phosphate

    • Coupled enzyme assays linking ATP hydrolysis to NADH oxidation

    • Radioactive assays using [γ-³²P]ATP

Based on studies of similar ABC transporters, reactions should be conducted at physiologically relevant temperatures (30-37°C) with carefully controlled pH (7.0-8.0) . Time-course experiments typically range from 5-60 minutes to determine the linear range of activity. The presence of potential transport substrates can be tested to identify compounds that might stimulate ATPase activity, providing clues to the physiological function of YknV.

How can researchers effectively study YknV conformational changes during the ATP hydrolytic cycle?

To investigate the conformational changes of YknV during ATP cycling, researchers should consider:

  • Molecular dynamics (MD) simulations examining:

    • ATP-bound state

    • ADP plus inorganic phosphate-bound state

    • ADP-bound state
      These simulations can reveal potential intermediate conformations during the transport cycle

  • Spectroscopic techniques:

    • Double Electron-Electron Resonance (DEER) spectroscopy to measure distances between spin-labeled domains during conformational changes

    • Fluorescence resonance energy transfer (FRET) using strategically placed fluorophores

  • Site-directed mutagenesis targeting:

    • Key residues in the A-loop

    • Helical sub-domain

    • "Coupling helices" region
      These regions show major rearrangements during ATP hydrolysis in similar ABC transporters

For comprehensive analysis, researchers should examine multiple potential intermediate states as demonstrated in studies of other ABC transporters, which revealed that ATP-hydrolysis induces conformational changes in the helical sub-domain region that are subsequently transferred to the transmembrane domains via the "coupling helices" .

How does YknV compare to characterized ABC transporters in Bacillus subtilis and what can be inferred about its specific function?

While YknV remains uncharacterized, comparative analysis with other B. subtilis ABC transporters provides insight into its potential function:

ABC TransporterKnown FunctionSequence Similarity to YknVStructural Features Comparison
YkcBCell wall component glycosylation; affects vancomycin susceptibilityModerate similarity in NBD regionContains glycosyltransferase domain absent in YknV
YknY/YknZAntimicrobial peptide resistanceHigh similaritySimilar domain organization
MalFGK₂E homologPotential maltose/carbohydrate transportLow similarityDifferent transmembrane organization

YknV likely participates in substrate export rather than import based on its domain arrangement, which is more similar to exporters than importers . Unlike YkcB, whose deletion leads to vancomycin tolerance and reduced biofilm formation, YknV has not been implicated in antibiotic resistance mechanisms, suggesting distinct physiological roles despite being present in the same organism . Based on homology with other ABC transporters, YknV may be involved in detoxification processes or lipid transport, though experimental validation is required.

What are the key methodological challenges in resolving the inter-domain communication mechanism in YknV?

Elucidating the inter-domain communication mechanism in YknV presents several challenging aspects:

  • Dynamic nature of conformational changes:

    • ABC transporters cycle through multiple conformational states difficult to capture simultaneously

    • Transient intermediate states may be essential but challenging to stabilize for structural studies

  • Technical challenges:

    • Crystallization difficulties due to membrane protein properties

    • Potential artifacts from detergent solubilization affecting native conformations

    • Resolution limitations in cryo-EM studies of smaller transporters

  • Functional validation approaches:

    • Design of cross-linking studies to trap specific conformational states

    • Creation of mutants with altered communication between NBDs and TMDs

    • Development of assays to correlate conformational changes with transport activity

Researchers should consider employing a combination of molecular dynamics simulations and experimental approaches as demonstrated in studies of other ABC transporters . Particular attention should be paid to the A-loop, helical sub-domain, and "coupling helices" regions, which have been identified as critical for transmitting conformational changes from the ATP-binding domains to the transmembrane domains in other ABC transporters .

How should researchers interpret contradictory experimental results regarding YknV function?

When encountering contradictory results in YknV research, consider the following analytical framework:

  • Experimental condition variations:

    • Buffer composition differences (particularly pH and ionic strength)

    • Presence/absence of lipids or membrane mimetics

    • Protein construct differences (full-length vs. truncated versions)

  • Systematic analysis approach:

    • Create a comparison table documenting all experimental conditions

    • Identify variables that correlate with observed differences

    • Test hypotheses about condition-dependent behavior

  • Consideration of model limitations:

    • ABC transporters often show context-dependent behavior

    • In vitro conditions may not fully recapitulate in vivo environment

    • Protein tags might influence activity or conformation

What bioinformatic approaches are most effective for predicting YknV transport substrates?

To predict potential substrates of the YknV transport system, researchers can employ these bioinformatic strategies:

  • Genomic context analysis:

    • Examine adjacent genes and operon structure

    • Identify regulatory elements controlling yknV expression

    • Search for co-expressed genes using transcriptomic data

  • Structural homology modeling:

    • Generate models based on crystallized ABC transporters with known substrates

    • Analyze substrate binding pocket characteristics

    • Perform molecular docking with candidate substrates

  • Evolutionary analysis:

    • Construct phylogenetic trees of related transporters with known functions

    • Identify conserved residues in substrate binding regions

    • Apply machine learning algorithms trained on characterized transporters

  • Integration with experimental data:

    • Use predictions to guide targeted metabolomic analysis

    • Design transport assays for highest-confidence predicted substrates

    • Validate predictions with site-directed mutagenesis of predicted binding site residues

This multi-faceted approach addresses the challenge of substrate prediction for uncharacterized transporters by leveraging both computational predictions and targeted experimental validation, similar to strategies used successfully for other ABC transporters .

What emerging technologies show the most promise for fully characterizing the structure-function relationship of YknV?

Several cutting-edge technologies offer significant potential for advancing YknV characterization:

  • Cryo-electron microscopy (cryo-EM):

    • Captures multiple conformational states in a single sample

    • Achieves near-atomic resolution without crystallization

    • Enables visualization of the protein in a more native-like environment

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps dynamic regions involved in conformational changes

    • Identifies substrate binding sites through protection patterns

    • Requires relatively small amounts of protein

  • AlphaFold2 and other AI structure prediction tools:

    • Generates high-confidence structural models

    • Predicts conformational flexibility and domain interactions

    • Enables structure-based hypothesis generation

  • Single-molecule techniques:

    • FRET for real-time observation of individual transporter molecules

    • Magnetic tweezers to apply force and study mechanosensitivity

    • Correlates ATP hydrolysis with conformational changes at the single-molecule level

These technologies can provide unprecedented insights into the conformational dynamics of ABC transporters like YknV, potentially resolving longstanding questions about the power stroke mechanism and intermediate states during the transport cycle .

How might genetic approaches complement biochemical studies to determine the physiological role of YknV in Bacillus subtilis?

Genetic approaches offer valuable complementary strategies to biochemical characterization:

  • Knockout and complementation studies:

    • Generate clean yknV deletion strains

    • Perform phenotypic analyses under various growth and stress conditions

    • Complement with wild-type and mutant variants to confirm phenotypes

  • Suppressor mutation analysis:

    • Identify second-site mutations that suppress yknV deletion phenotypes

    • Map genetic interaction networks

    • Discover functional relationships with other cellular processes

  • Transcriptional regulation studies:

    • Determine expression patterns under different growth conditions

    • Identify transcription factors regulating yknV expression

    • Construct reporter fusions to monitor expression in real-time

  • Synthetic lethality screening:

    • Create a library of double mutants combining yknV deletion with other genes

    • Identify genetic interactions revealing functional partnerships

    • Map the position of YknV in cellular pathways

These genetic approaches can provide crucial physiological context for biochemical findings, similar to studies of other transporters like YkcB, where knockout studies revealed unexpected roles in antibiotic susceptibility and biofilm formation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.