Recombinant Bacillus subtilis Uncharacterized ABC transporter permease protein ytlD (ytlD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Uncharacterized ABC Transporter Permease Protein YtlD (YtlD)

The Recombinant Bacillus subtilis Uncharacterized ABC Transporter Permease YtlD (YtlD) is a heterologously expressed protein derived from the Gram-positive bacterium Bacillus subtilis. As part of the ATP-binding cassette (ABC) transporter superfamily, YtlD is hypothesized to play roles in substrate transport across cellular membranes, though its precise biological function remains uncharacterized . The recombinant form of this protein enables biochemical and structural studies to elucidate its mechanisms and applications.

Protein Characteristics

  • Gene Name: ytlD (synonyms: BSU14370) .

  • UniProt ID: O34649 .

  • Sequence: A partial sequence (length not fully specified) expressed as a recombinant protein fused with an N-terminal His tag for purification .

  • Source: Produced in Escherichia coli .

  • Purity: >85% as confirmed by SDS-PAGE .

Table 1: Key Parameters of Recombinant YtlD

ParameterDetails
SpeciesBacillus subtilis (strain 168)
Expression SystemE. coli
TagHis tag (position unspecified)
FormLyophilized powder
Storage-20°C/-80°C (long-term); 4°C (short-term working aliquots)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); 5–50% glycerol for stability

Production and Purification

Recombinant YtlD is synthesized using B. subtilis-optimized expression systems. Key steps include:

  1. Gene Cloning: The ytlD gene is inserted into a plasmid under a strong promoter (e.g., P<sub>grac</sub>) .

  2. Expression: Host cells (typically E. coli) are induced with IPTG or autoinduction systems for protein production .

  3. Purification: Affinity chromatography (e.g., Ni-NTA resin) isolates the His-tagged protein .

  4. Quality Control: SDS-PAGE and Western blotting confirm purity and identity .

Functional Hypotheses and Related ABC Transporters

While YtlD’s exact role is unconfirmed, ABC transporters in B. subtilis are implicated in:

  • Nutrient Uptake: Import of amino acids, ions, or metabolites .

  • Antibiotic Resistance: Export of toxins or cell wall-modifying molecules (e.g., YtrBCDEF) .

  • Cell Wall Homeostasis: Regulation of peptidoglycan synthesis and sporulation .

Table 2: Comparison with Related B. subtilis ABC Transporters

ProteinOperonFunctionKey References
YtlDUncharacterizedHypothesized substrate transport
YtrBCDEFytrABCDEFCell wall thickening, antibiotic response
YknZyknZUncharacterized permease activity

Challenges and Research Gaps

  • Functional Characterization: No direct studies on YtlD’s substrates or transport directionality (import/export) .

  • Structural Insights: No resolved 3D structure; computational models (e.g., AlphaFold) are unavailable for YtlD, unlike homologs such as Klebsiella YbtQ .

  • Regulatory Mechanisms: Unknown transcriptional or post-translational regulation .

Applications in Biotechnology

  • Drug Discovery: Potential target for antimicrobials if linked to essential transport pathways .

  • Protein Engineering: Platform for studying ABC transporter mechanics due to B. subtilis’s GRAS status and secretion efficiency .

  • Industrial Enzymes: Secretion systems in B. subtilis could leverage YtlD for metabolite export .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ytlD; BSU30620; Uncharacterized ABC transporter permease protein YtlD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ytlD
Target Protein Sequence
MRNSKETIDLLHEQYQFKQKKEKWKVHSFQLAIFILFFSGWEISSRQGWIDPLIFSSPSA VWRLLLEKLGDGSLLSHIGVTLFETVLGFLLGTFMGTCLAALLWWSNRLARILDPYLVIL NAMPKVALGPILIVALGPSFISIIAMGAIISVIITTIVVYTAFQEVDENYTKVMKTFGAK KWVIFKEVILPASSPAIISTLKVNVGLSWVGVIVGEFLVSKVGLGYMIIYGFQVFNFTLV FLSLLIIAIFATLMYQGVELLEKKWTKGRT
Uniprot No.

Target Background

Function
This protein is part of a binding-protein-dependent transport system. It is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of the ytlD gene in Bacillus subtilis?

The ytlD gene is part of an operon structure typical of ABC transporters in B. subtilis. ABC transporter operons generally consist of genes encoding nucleotide-binding domains (NBDs) that bind and hydrolyze ATP, and transmembrane domains (TMDs) that form the substrate translocation pathway . In the case of ytlD, it encodes a permease protein that functions as part of the transmembrane domain component. The complete operon typically includes genes encoding the NBD protein, one or more permease proteins, and potentially a substrate-binding protein depending on whether it functions as an importer or exporter . When investigating ytlD, it's essential to examine the entire operon structure using genome browsers specific for B. subtilis to identify potential functional partners that may constitute the complete ABC transporter complex.

What expression systems are recommended for recombinant production of ytlD protein?

For recombinant production of ytlD protein, several B. subtilis-based expression systems can be employed with optimization strategies:

  • Plasmid-based expression systems: Autonomous plasmid vectors incorporating strong inducible promoters (e.g., Pspac, PxylA) offer high-yield expression of ytlD .

  • Integrated expression systems: Chromosomal integration methods provide stable expression without antibiotic selection pressure, ideal for long-term studies .

  • Secretion-based systems: For easier purification, expression can be coupled with secretion signals, though this may be challenging for membrane proteins like ytlD .

The following table outlines recommended expression systems for membrane proteins in B. subtilis:

Expression SystemPromoterInduction MethodAdvantagesLimitations
pHT vector seriesP43ConstitutiveSimple expressionNo regulation
pHCMC seriesPxylAXylose-inducibleTight regulationMedium copy number
pHT01PgracIPTG-inducibleHigh expressionPossible leaky expression
Genome integrationNative ytlD promoterNative regulationPhysiological levelsLower yield

When expressing ytlD, it's crucial to incorporate affinity tags (His6 or Strep-tag) for purification while considering their potential impact on protein folding and function .

What are the challenges in purifying ABC transporter permease proteins like ytlD?

Purifying ABC transporter permease proteins like ytlD presents several challenges due to their hydrophobic nature and membrane localization. Traditional detergent-based methods often lead to protein instability and functional loss. Recent methodologies have introduced detergent-free approaches, particularly using styrene-maleic acid (SMA) copolymers that extract membrane proteins within their native lipid environment .

The SMA extraction method offers significant advantages:

  • It maintains the protein within its native lipid bilayer environment

  • It preserves protein stability and function better than detergent extraction

  • It allows for purification of the protein-lipid complex (SMALP) via affinity chromatography

The purification protocol involves:

  • Expression of ytlD with appropriate affinity tags

  • Cell disruption and membrane fraction isolation

  • Membrane solubilization using SMA copolymer (typically 2.5%)

  • Affinity purification of the resulting SMALPs

  • Characterization of the purified protein-lipid complex

This method has been successfully applied to various eukaryotic ABC transporters (ABCB1, ABCC1, ABCC4, ABCG2, and ABCC7) and shows promise for prokaryotic ABC transporters like ytlD .

How can researchers determine if ytlD protein is successfully expressed in recombinant systems?

Verification of ytlD expression in recombinant systems requires multiple complementary approaches:

  • Western blotting: Using antibodies against ytlD or attached affinity tags (His-tag, FLAG-tag) to detect the protein in membrane fractions. Expected molecular weight analysis should account for possible post-translational modifications .

  • Fluorescent fusion proteins: Creating ytlD-GFP fusion constructs to visualize membrane localization using fluorescence microscopy. This approach can confirm both expression and proper membrane targeting .

  • Mass spectrometry: Analyzing tryptic digests of membrane fractions to identify peptides specific to ytlD. This technique provides high specificity and can determine expression levels .

  • Functional assays: Measuring ATP hydrolysis activity in membrane preparations as a functional readout of ABC transporter expression. For ytlD specifically, establishing a correlation between expression and transport activity of potential substrates .

A typical expression verification workflow involves:

  • Initial screening via Western blot of whole-cell lysates

  • Subcellular fractionation to confirm membrane localization

  • Quantitative assessment through densitometry of Western blots compared to known standards

  • Functional validation through transport or ATPase assays

What methodologies are most effective for determining the substrate specificity of uncharacterized ABC transporter permeases like ytlD?

Determining substrate specificity of uncharacterized ABC transporters like ytlD requires a multi-faceted approach combining genomic, biochemical, and biophysical techniques:

  • Genomic context analysis: Examining genes adjacent to ytlD in the B. subtilis genome can provide clues about potential substrates. ABC transporters are often co-localized with genes involved in the metabolism of their substrates .

  • Comparative genomics: Identifying ytlD homologs in other organisms with known functions can suggest potential substrates. Phylogenetic analysis can place ytlD within known ABC transporter families .

  • Transport assays: Developing in vivo and in vitro transport assays using:

    • Radioactively labeled candidate substrates

    • Fluorescent substrate analogs

    • Growth phenotype analysis with potential toxic substrates

  • Binding studies: Substrate binding can be assessed through:

    • Isothermal titration calorimetry (ITC)

    • Surface plasmon resonance (SPR)

    • Fluorescence-based binding assays

  • Structural analysis: Cryo-EM or X-ray crystallography of ytlD in complex with potential substrates can definitively establish substrate specificity .

The most effective substrate identification workflow combines:

  • Initial bioinformatic prediction of substrate class

  • Medium-throughput screening of candidate substrates based on structural similarity

  • Validation through direct binding and transport assays

  • Confirmation via genetic approaches (deletion/complementation)

How can researchers effectively model the structure-function relationship of ytlD protein without crystallographic data?

In the absence of crystallographic data, several computational and experimental approaches can effectively model ytlD structure-function relationships:

  • Homology modeling: Using solved structures of homologous ABC transporter permeases as templates. The quality depends on sequence similarity, which should be carefully assessed .

  • Ab initio modeling with experimental constraints: Combining computational prediction with experimental data from:

    • Cross-linking mass spectrometry (XL-MS) to identify spatial proximities

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map solvent-accessible regions

    • Cysteine accessibility studies to probe transmembrane topology

  • Molecular dynamics simulations: Refining homology models through MD simulations in membrane environments to assess stability and conformational dynamics .

  • Evolutionary coupling analysis: Identifying co-evolving residues that likely interact in the three-dimensional structure, providing distance constraints for modeling.

  • Cryo-EM: While not atomic resolution, cryo-EM can provide medium-resolution structural information about membrane proteins like ytlD in native-like environments .

A comprehensive structural analysis workflow includes:

  • Generating initial models through homology modeling

  • Validating transmembrane topology through experimental approaches

  • Refining models using MD simulations and experimental constraints

  • Testing structure-based functional predictions through mutagenesis

This integrative approach has been successful for other ABC transporters and can reveal functional motifs and potential substrate-binding sites in ytlD.

What strategies can be employed to optimize the secretion level of ytlD in B. subtilis expression systems?

Optimizing ytlD secretion in B. subtilis requires specialized approaches due to its nature as a membrane protein rather than a typical secreted protein. For study purposes, creating secretable versions involves:

  • Signal peptide optimization: The choice of signal peptide significantly impacts secretion efficiency. A systematic screening of B. subtilis signal peptides (SP) reveals varying efficiencies:

Signal PeptideOriginRelative Secretion Efficiency
SPAmyEα-amylaseHigh (100%)
SPAprESubtilisinMedium-high (75-90%)
SPLipALipase AMedium (50-70%)
SPPhoDPhosphodiesteraseVariable (30-80%)
SPYncMPutative lipoproteinHigh for specific proteins
  • Domain engineering: For membrane proteins like ytlD, creating secretable versions requires:

    • Identification of soluble domains

    • Construction of chimeric proteins fusing soluble domains to secretion signals

    • Deletion of transmembrane domains while preserving functional epitopes

  • Host strain optimization: Engineered B. subtilis strains with enhanced secretion capabilities:

    • Protease-deficient strains (ΔnprE, ΔaprE, Δepr, etc.)

    • Strains overexpressing secretion machinery components (SecA, PrsA)

    • Strains with modified cell wall properties (ΔdltA, ΔtagO)

  • Process optimization: Fermentation parameters significantly impact secretion:

    • Lower cultivation temperatures (25-30°C) improve folding

    • Controlled pH (6.5-7.2) enhances stability

    • Optimized media composition with appropriate carbon/nitrogen ratios

    • Feed strategies maintaining slower, controlled growth rates

A systematic optimization approach involves initial small-scale screening followed by statistical design of experiments (DoE) for multi-parameter optimization at bioreactor scale.

How can researchers effectively distinguish between transport activity and other functions of ytlD protein?

ABC transporters like ytlD may possess functions beyond simple transport. Distinguishing between transport and other activities requires:

  • Transport-specific assays: Direct measurement of substrate translocation using:

    • Inside-out membrane vesicles loaded with fluorescent substrates

    • Reconstituted proteoliposomes with purified ytlD

    • Whole-cell transport assays with labeled substrates

  • ATPase activity measurements: ABC transporters couple ATP hydrolysis to transport, allowing:

    • Baseline ATPase activity measurement

    • Substrate-stimulated ATPase activity assessment

    • Comparison of ATP consumption with transport rates

  • Separation of function mutations: Targeted mutations in:

    • Walker A/B motifs to abolish ATP hydrolysis

    • Potential substrate-binding sites

    • Transmembrane domains involved in translocation

    • Regions potentially involved in regulatory interactions

  • Protein-protein interaction studies: Identifying interaction partners through:

    • Bacterial two-hybrid assays

    • Co-immunoprecipitation

    • Cross-linking followed by mass spectrometry

The correlation between ATP hydrolysis and transport can be assessed through the following parameters:

ParameterDefinitionTypical ValuesSignificance
Basal ATPaseATP hydrolysis without substrate5-20 nmol/min/mgBackground activity
VmaxMaximum ATPase rate50-200 nmol/min/mgCatalytic capacity
Km (ATP)ATP concentration at half Vmax0.1-0.5 mMATP binding affinity
Transport coupling ratioATP molecules/substrate transported1-2 ATP/moleculeEnergetic efficiency
Substrate stimulationFold increase in ATPase with substrate1.5-5 foldTransport coupling

Uncoupling of ATP hydrolysis from transport may indicate regulatory or structural roles beyond simple substrate translocation.

What are the best approaches for investigating ytlD protein interactions with other components of the ABC transporter complex?

Investigating ytlD interactions with other ABC transporter components requires specialized techniques for membrane protein complexes:

  • Co-purification approaches:

    • Tandem affinity purification (TAP) tagging of ytlD to identify interaction partners

    • Sequential co-immunoprecipitation experiments using antibodies against different components

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine complex stoichiometry

  • In vivo interaction studies:

    • Förster resonance energy transfer (FRET) between fluorescently labeled components

    • Bimolecular fluorescence complementation (BiFC) for direct visualization of interactions

    • Bacterial two-hybrid systems adapted for membrane proteins

  • Cross-linking mass spectrometry (XL-MS):

    • In vivo crosslinking to capture transient interactions

    • MS/MS analysis to identify crosslinked peptides

    • Structural mapping of interaction interfaces

  • Functional complementation:

    • Construction of chimeric proteins with components from characterized ABC transporters

    • Genetic complementation of known ABC transporter mutants

    • Analysis of dominant negative mutations

The typical ABC transporter complex formation involves specific components with defined roles:

ComponentFunctionDetection MethodTypical Stoichiometry
NBDATP binding/hydrolysisATPase activity2 (homodimer or heterodimer)
Permease (ytlD)Substrate translocationTransport assays2 (homodimer or heterodimer)
Substrate-binding proteinSubstrate capture (importers)Binding assays1-2
Accessory proteinsRegulation/stabilityCo-IP, proteomicsVariable

A comprehensive interaction study should map both the physical contacts and functional cooperation between ytlD and its partner proteins in the ABC transporter complex.

What approaches are most effective for generating site-directed mutations in ytlD to study structure-function relationships?

Site-directed mutagenesis of ytlD requires specialized approaches for B. subtilis genes, with several effective methodologies:

  • PCR-based site-directed mutagenesis:

    • QuikChange method adapted for B. subtilis plasmids

    • Gibson Assembly with mutagenic primers

    • Overlap extension PCR incorporating desired mutations

  • CRISPR-Cas9 genome editing in B. subtilis:

    • Direct chromosomal mutation of ytlD in its native context

    • Workflow includes:
      a) Design of guide RNA targeting ytlD
      b) Construction of repair template with desired mutation
      c) Transformation and selection of mutants
      d) Verification by sequencing

  • Alanine-scanning mutagenesis:

    • Systematic replacement of residues with alanine

    • Particularly valuable for identifying functional residues in transmembrane segments

    • Can be performed in blocks or individual residues

  • Conservation-guided mutagenesis:

    • Targeting highly conserved residues identified through multiple sequence alignment

    • Focus on signature motifs of ABC transporters:
      a) Walker A/B motifs in NBDs
      b) Q-loop and H-loop
      c) Coupling helices in TMDs
      d) Substrate-binding residues

For functional analysis of mutations, a systematic approach includes:

Mutation TypeTarget ResiduesExpected OutcomeAnalysis Method
Functional motifsWalker A/B, signature motifImpaired ATP hydrolysisATPase assays
TM helicesCharged/polar residuesAltered substrate specificityTransport assays
Cytoplasmic loopsInterface residuesDisrupted NBD-TMD communicationConformational studies
Conservative substitutionsSimilar amino acidsSubtle functional changesDetailed kinetic analysis
Radical substitutionsDifferent propertiesSignificant functional changesComplementation tests

The most informative mutations are those that separate different functions (e.g., ATP binding vs. hydrolysis, substrate binding vs. translocation), allowing delineation of the mechanism.

What are the most suitable heterologous expression systems for functional characterization of ytlD when B. subtilis is not ideal?

While B. subtilis is the native host for ytlD, alternative expression systems may offer advantages for specific experimental purposes:

  • E. coli-based systems:

    • BL21(DE3) with T7 promoter-driven expression

    • C41/C43(DE3) strains optimized for membrane proteins

    • LEMO21(DE3) with tunable expression levels

    • Advantages include high transformation efficiency and extensive genetic tools

    • Limitations include different membrane composition and potential folding issues

  • Cell-free expression systems:

    • E. coli extract-based cell-free systems with added lipids/detergents

    • Wheat germ extract systems for reduced toxicity

    • Advantages include rapid expression and direct incorporation into nanodiscs or liposomes

    • Limitations include lower yields and higher costs

  • Yeast expression systems:

    • Pichia pastoris (Komagataella phaffitis) with methanol-inducible promoters

    • Saccharomyces cerevisiae with GAL promoters

    • Advantages include eukaryotic membrane environment and post-translational machinery

    • Limitations include different lipid composition and potential glycosylation

  • Mammalian cell expression:

    • HEK293 cells for transient expression

    • CHO cells for stable cell lines

    • Advantages include complex eukaryotic membrane environment

    • Limitations include lower yields and higher costs

Comparative expression analysis across systems:

Expression SystemTypical YieldExpression TimeMembrane EnvironmentCostTechnical Difficulty
B. subtilis0.5-5 mg/L24-48 hrsNative (Gram+)LowMedium
E. coli1-10 mg/L16-24 hrsGram-Very lowLow
Cell-free0.1-1 mg/mL4-24 hrsDefined lipidsHighMedium
P. pastoris2-10 mg/L48-96 hrsEukaryoticMediumHigh
Mammalian cells0.1-2 mg/L48-72 hrsComplex eukaryoticVery highVery high

The optimal choice depends on the specific experimental goals, with E. coli offering simplicity and high yields, while cell-free systems provide greater control over the membrane environment.

How can researchers effectively analyze contradictory data regarding ytlD function and localization?

Contradictory data regarding ABC transporter permease proteins like ytlD are common due to experimental variables and complex biology. Resolving these contradictions requires systematic approaches:

  • Standardization of experimental conditions:

    • Documenting detailed protocols including strain backgrounds, growth conditions, and expression methods

    • Establishing positive and negative controls for localization and functional assays

    • Using multiple independent clones and biological replicates

  • Multi-method verification:

    • Combining different localization techniques:
      a) Fluorescent protein fusions
      b) Immunofluorescence microscopy
      c) Biochemical fractionation
      d) Protease accessibility assays

    • Cross-validating functional data using independent methods:
      a) Transport assays with different detection methods
      b) ATPase activity measurements
      c) Binding studies with varied techniques

  • Context-dependent analysis:

    • Evaluating protein function in:
      a) Native vs. heterologous hosts
      b) Different growth phases and conditions
      c) Stress vs. normal conditions

    • Considering potential post-translational modifications and regulatory mechanisms

  • Statistical and data analysis approaches:

    • Meta-analysis of multiple experiments

    • Bayesian approaches to integrate conflicting data sets

    • Principal component analysis to identify key variables affecting outcomes

Framework for resolving contradictory data:

Contradiction TypeExampleResolution ApproachValidation Method
LocalizationMembrane vs. cytoplasmicTemporal analysis of localizationTime-course imaging
Substrate specificityDifferent substrates reportedCompetitive transport assaysDirect binding studies
FunctionTransport vs. regulatory roleSeparation-of-function mutationsGenetic epistasis analysis
StructureDifferent predicted topologiesCysteine accessibility mappingCross-linking studies
Expression levelVariable detection in proteomicsQuantitative Western blottingTargeted mass spectrometry

This systematic approach acknowledges that contradictions often reveal biological complexity rather than experimental error, potentially uncovering conditional functionality or regulatory mechanisms.

What are the most effective methods for studying the role of ytlD in antimicrobial resistance mechanisms?

ABC transporters often contribute to antimicrobial resistance, making ytlD a potential factor in B. subtilis resistance mechanisms. Effective study methods include:

  • Genetic approaches:

    • Construction of ytlD deletion and overexpression strains

    • Determination of minimum inhibitory concentrations (MICs) for various antimicrobials

    • Complementation studies with wild-type and mutant versions

    • Construction of reporter fusions to monitor expression in response to antimicrobials

  • Biochemical approaches:

    • Direct transport assays using fluorescent or radiolabeled antimicrobials

    • Competition assays between antimicrobials and known substrates

    • ATPase stimulation studies to identify potential antimicrobial substrates

    • Binding studies using surface plasmon resonance or isothermal titration calorimetry

  • Physiological and systems approaches:

    • Transcriptomic analysis of ytlD expression under antimicrobial stress

    • Metabolomic profiling to identify changes in ytlD mutants

    • Biofilm formation and resistance studies

    • Fitness competition assays in the presence of antimicrobials

  • Structural approaches:

    • Modeling of antimicrobial binding sites

    • Identification of resistance mutations in ytlD

    • Structure-guided design of inhibitors

Antimicrobial resistance profiling protocol:

StageMethodOutcome MeasureSignificance
Initial screeningDisk diffusion assaysZone of inhibitionQualitative resistance
Quantitative assessmentBroth microdilutionMIC valuesQuantitative resistance
Mechanism studyEfflux inhibitor studiesMIC reductionConfirmation of efflux
Direct transportFluorescent substrate accumulationIntracellular concentrationDirect evidence
Expression analysisqRT-PCR/Western blotExpression levelRegulation data
Resistance selectionSerial passageResistance mutationsEvolution of resistance

The relationship between ABC transporter activity and antimicrobial resistance is complex, often involving substrate specificity changes that can be detected through carefully designed comparative studies across multiple antimicrobial classes.

What computational tools and databases are most valuable for predicting ytlD function and evolutionary relationships?

Predicting ytlD function and evolutionary relationships requires specialized bioinformatic approaches for ABC transporters:

  • Sequence analysis tools:

    • TCDB (Transporter Classification Database): Classification within ABC transporter family

    • BLAST/PSI-BLAST: Identification of homologs across species

    • HMMer: Profile-based searches using hidden Markov models

    • InterPro/Pfam: Identification of functional domains

  • Structure prediction tools:

    • AlphaFold2/RoseTTAFold: State-of-the-art protein structure prediction

    • SWISS-MODEL: Homology modeling based on known ABC transporter structures

    • TMHMM/TOPCONS: Transmembrane topology prediction

    • ConSurf: Evolutionary conservation mapping onto structures

  • Genomic context analysis:

    • STRING: Protein-protein interaction networks and genomic neighborhood

    • IMG/MicrobesOnline: Comparative genomics and operon structure analysis

    • SubtiWiki: B. subtilis-specific genome browser and annotation

  • Specialized ABC transporter resources:

    • ABCMdb: ABC Membrane Protein Database

    • TransportDB: Transport protein analysis

    • Membrane Protein Data Bank: Structural information

Workflow for comprehensive computational analysis:

Analysis StepToolsOutputInterpretation
Initial characterizationTCDB, PfamABC transporter classificationFamily/subfamily assignment
Homology detectionPSI-BLAST, HMMerHomologs across speciesEvolutionary conservation
Genomic contextSTRING, SubtiWikiOperonic structure, functional partnersFunctional associations
Structure predictionAlphaFold2, SWISS-MODEL3D structural modelSubstrate binding sites, membrane topology
Evolutionary analysisMEGA, MrBayesPhylogenetic treeEvolutionary history
Substrate predictionTransportTP, machine learningPotential substratesFunctional hypothesis

The most valuable prediction combines multiple lines of evidence, with greater confidence assigned to predictions supported by different computational approaches. For uncharacterized proteins like ytlD, computational predictions should guide experimental design rather than replace empirical testing.

What are the optimal conditions for solubilizing and purifying ytlD protein while maintaining its native structure?

Solubilization and purification of ytlD requires specialized approaches for membrane proteins:

  • Membrane preparation:

    • Mechanical disruption of B. subtilis cells (French press or sonication)

    • Differential centrifugation to isolate membrane fraction

    • Washing steps to remove peripheral proteins

  • Solubilization methods comparison:

Solubilization MethodAdvantagesLimitationsTypical YieldStructural Integrity
Detergent (DDM)Well-establishedPotential denaturationModerate (40-60%)Variable
Detergent (LMNG)Enhanced stabilityHigh costGood (50-70%)Good
SMA copolymerNative lipid environmentLimited compatibilityModerate (30-50%)Excellent
AmphipolsStabilization without detergentRequires initial detergentModerate (40-60%)Very good
Nanodiscs (MSP)Defined bilayer environmentComplex preparationLow (20-40%)Excellent
  • Purification strategy:

    • Affinity chromatography using engineered tags (His, Strep, FLAG)

    • Ion exchange chromatography for additional purification

    • Size exclusion chromatography for final polishing and buffer exchange

    • On-column detergent exchange for improved stability

  • Stability optimization:

    • Addition of lipids during purification (POPC, POPE, cardiolipin)

    • Inclusion of stabilizing additives (glycerol, cholesterol hemisuccinate)

    • Temperature control (typically 4°C throughout purification)

    • Optimization of pH and ionic strength

The optimal purification protocol involves:

  • Initial solubilization screening to identify conditions that maintain ATPase activity

  • Small-scale purification trials with activity measurements

  • Scaled-up purification with stability assessment

  • Quality control through homogeneity analysis (SEC-MALS, negative stain EM)

Styrene-maleic acid (SMA) copolymer extraction has emerged as particularly promising for ABC transporters, maintaining them in native lipid environments without conventional detergents .

How can researchers effectively design experiments to determine if ytlD functions as part of an importer or exporter system?

Determining whether ytlD functions in an import or export capacity requires systematic experimental design:

  • Genetic architecture analysis:

    • Import systems typically include substrate-binding proteins (SBPs)

    • Export systems generally lack SBPs but may have fused substrate-binding domains

    • Examination of operon structure and predicted protein domains can provide initial classification

  • Transport directionality assays:

    • Inside-out membrane vesicles: Substrates accumulating against a concentration gradient suggest export function

    • Right-side-out vesicles: Substrate accumulation indicates import function

    • Intact cell uptake vs. efflux measurements using carefully selected substrates

  • Biochemical approaches:

    • ATP-dependent substrate binding: Different patterns for importers vs. exporters

    • Vanadate trapping experiments: Different conformational states are captured

    • Cross-linking studies to identify substrate access pathways

  • Reconstitution studies:

    • Proteoliposome reconstitution with defined orientation

    • Substrate transport measurements with controlled concentration gradients

    • Analysis of transport directionality and energetics

Experimental decision tree:

ExperimentResult for ImporterResult for ExporterControls
Gene cluster analysisSBP genes presentNo SBP genesKnown importers/exporters
Substrate uptake assayEnhanced in overexpressionReduced in overexpressionTransport-deficient mutant
Drug resistanceSensitization when overexpressedResistance when overexpressedKnown MDR transporters
ATP stimulation patternATP binding initiates transport cycleSubstrate binding initiates ATP cyclesWalker A/B mutants
Reconstituted systemInward transport requiring SBPsOutward transport without SBPsDefined orientation controls

The collected evidence across multiple experimental approaches provides strong classification of ytlD as either an importer or exporter component, guiding further functional characterization.

What high-throughput screening methods can researchers employ to identify potential substrates or inhibitors of ytlD?

High-throughput screening for ytlD substrates and inhibitors can utilize several complementary approaches:

  • Growth-based screening platforms:

    • Toxic compound resistance/sensitivity screening in ytlD-overexpression strains

    • Substrate utilization screens using Biolog phenotype microarrays

    • Genetic interaction screens with ytlD deletion/overexpression

  • Biochemical high-throughput assays:

    • ATPase activity modulation screening:
      a) Colorimetric phosphate release assays (malachite green)
      b) Coupled enzyme assays (pyruvate kinase/lactate dehydrogenase)
      c) Luminescent ADP detection assays

    • Transport assays using fluorescent substrates:
      a) Membrane vesicle-based accumulation
      b) Whole-cell fluorescence monitoring
      c) FRET-based substrate interaction assays

  • Biophysical screening methods:

    • Thermal shift assays (differential scanning fluorimetry)

    • Surface plasmon resonance binding screens

    • Fragment-based screening using NMR

  • In silico approaches:

    • Virtual screening against modeled substrate-binding sites

    • Pharmacophore-based screening

    • Machine learning prediction of substrates based on known transporters

Workflow optimization for different screening objectives:

Screening ObjectivePrimary ScreenSecondary ValidationThroughputSuccess Rate
Natural substrate identificationBiolog PM platesTransport assaysMedium (100s)5-15%
Inhibitor discoveryATPase modulationGrowth inhibitionHigh (1000s)0.1-1%
Substrate specificity profilingStructural analogsCompetitive inhibitionMedium (100s)10-30%
Allosteric modulatorsThermal shiftConformational analysisHigh (1000s)0.5-2%

For ytlD specifically, combining computational prediction with focused libraries of compounds related to predicted substrate classes significantly increases the likelihood of identifying physiologically relevant interactions compared to random compound screening.

What are the most effective approaches for studying the role of ytlD in stress response mechanisms in B. subtilis?

ABC transporters often play crucial roles in stress responses. Effective approaches for investigating ytlD's role include:

  • Transcriptional regulation analysis:

    • qRT-PCR analysis of ytlD expression under various stresses

    • Promoter-reporter fusions (lacZ, luciferase) to monitor expression dynamics

    • ChIP-seq to identify transcription factors regulating ytlD

    • Single-cell expression analysis using fluorescent reporters

  • Phenotypic characterization:

    • Stress survival assays comparing wild-type and ytlD mutants:
      a) Oxidative stress (H₂O₂, paraquat)
      b) Osmotic stress (salt, sugar)
      c) pH stress (acid, alkaline)
      d) Temperature stress (heat shock, cold shock)
      e) Antimicrobial compounds

    • Growth curve analysis under stress conditions

    • Long-term survival and stationary phase studies

  • Omics approaches:

    • Transcriptomics: RNA-seq comparing wildtype vs. ytlD mutants under stress

    • Proteomics: Changes in protein abundance and post-translational modifications

    • Metabolomics: Altered metabolite profiles in response to stress

    • Lipidomics: Membrane composition changes

  • Interaction studies:

    • Stress-dependent protein-protein interactions

    • Co-regulation with known stress response systems

    • Genetic interaction screens under stress conditions

Stress response characterization protocol:

Stress TypeAssay MethodParameters MeasuredExpected Phenotype If Involved
OxidativeH₂O₂ challengeSurvival rateDecreased survival in Δytld
OsmoticNaCl gradient platesGrowth zoneGrowth inhibition at lower concentrations
Membrane integrityMembrane permeabilization assaysDye uptakeIncreased permeability in Δytld
Nutrient limitationMinimal media growthLag phase, growth rateExtended lag or reduced growth rate
Combined stressesCheckerboard assaysGrowth inhibitionSynergistic effects with other stressors

The involvement of ytlD in stress responses would be confirmed by both altered expression patterns under stress and phenotypic consequences of gene deletion or overexpression, particularly if complementation with the wild-type gene restores normal stress resistance.

What are the critical experimental controls needed when characterizing ytlD function in recombinant systems?

  • Expression controls:

    • Empty vector controls to account for vector effects

    • Inactive mutant controls (e.g., Walker A/B mutations in ATP-binding domain)

    • Expression level normalization across different constructs

    • Appropriate tags/fusions on both N- and C-termini to verify full-length expression

    • Western blotting to confirm correct protein size and absence of degradation

  • Functional controls:

    • Positive control ABC transporters with known function

    • Background transport measurements in untransformed cells

    • Competitive inhibition controls to confirm specificity

    • ATP-dependence controls (non-hydrolyzable ATP analogs)

    • Temperature-dependent controls (active vs. inactive transport)

  • Localization controls:

    • Membrane fraction verification using known membrane markers

    • Protease accessibility assays to confirm orientation

    • Multiple subcellular markers for co-localization studies

    • Negative controls for non-specific binding in immunofluorescence

  • System-specific controls:

    • Proper folding verification (native vs. SDS-PAGE mobility)

    • Oligomeric state analysis (native PAGE, crosslinking)

    • Lipid composition controls in reconstituted systems

    • pH and ionic strength controls for activity measurements

Essential control framework for comprehensive characterization:

Experiment TypeCritical ControlsPurposeImplementation
Expression analysisEmpty vector, housekeeping geneAccount for vector effects, normalize expressionParallel transformation and analysis
Transport assaysNo ATP, non-hydrolyzable ATP analogVerify ATP dependenceSide-by-side assays with ATP variants
Substrate specificityStructurally related non-substratesConfirm selectivityCompetitive inhibition studies
LocalizationMembrane marker, cytoplasmic markerVerify correct targetingCo-localization studies
Interaction studiesUnrelated membrane proteinControl for non-specific interactionsParallel pulldown experiments
ComplementationInactive mutant versionVerify function-specific complementationParallel transformation of mutants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.