Recombinant Bacillus subtilis Uncharacterized ABC transporter permease yclI (yclI)

Shipped with Ice Packs
In Stock

Description

Introduction to YclI

Recombinant Bacillus subtilis Uncharacterized ABC Transporter Permease YclI (YclI) is a protein encoded by the yclI gene in Bacillus subtilis subsp. subtilis str. 168. ABC (ATP-binding cassette) transporters are integral membrane proteins involved in the ATP-driven transport of substrates across cellular membranes. While YclI is annotated as an uncharacterized permease, its classification within the ABC transporter superfamily suggests potential roles in nutrient uptake, toxin efflux, or cell wall maintenance.

Gene Information

PropertyDetails
Gene NameyclI
SynonymsABC transporter permease
Gene ID938279 (NCBI)
UniProt IDP94412
Operon ContextNot explicitly defined in current literature; potential standalone gene.

Functional Hypotheses

  • Role in Transport: As a permease subunit of an ABC transporter, YclI likely contributes to substrate translocation across the membrane.

  • Operon Context: While unlinked to characterized operons, ABC permeases often function in tandem with nucleotide-binding domains (NBDs) and substrate-binding proteins (SBPs).

  • Homology: Structural similarity to B. subtilis YtrC/YtrD (cell wall homeostasis) and YclN (petrobactin transport) suggests potential roles in metabolite transport or stress response .

Key Studies

Study FocusFindingsReference
Expression AnalysisRecombinant YclI expressed in E. coli retains stability (>90% purity).
BioinformaticsPredicted transmembrane helices align with ABC permease topology.UniProt [P94412]
Functional ContextyclI homologs in B. subtilis (e.g., ytrC, yclN) are linked to cell wall modulation and siderophore transport.

Comparative Analysis of ABC Transporters

TransporterFunctionOperonSubstrate
YclIUncharacterizedStandaloneUnknown
YtrBCDEFCell wall homeostasisytrGABCDEFPeptidoglycan precursors
YclNOPQPetrobactin transportyclNOPQSiderophores
BceABBacitracin resistancebceABRSBacitracin

Sources:

Applications and Experimental Use

Recombinant YclI is primarily utilized for:

  • Structural Studies: Crystallization trials to resolve transmembrane topology.

  • Functional Assays: Substrate-binding experiments (e.g., radiolabeled ligands).

  • Antibody Production: Immunogen for polyclonal antibody generation.

Limitations and Future Directions

  • Unresolved Substrate: The specific substrate(s) transported by YclI remain unidentified.

  • Regulatory Mechanisms: Transcriptional control (e.g., promoter elements, regulatory proteins) is uncharacterized.

  • In Vivo Role: Knockout studies are needed to elucidate phenotypic impacts (e.g., sporulation, biofilm formation).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion.
Synonyms
yclI; BSU03740; Uncharacterized ABC transporter permease YclI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yclI
Target Protein Sequence
MNFIKRAFWNMKAKKGKTLLQLFVFTVICVFVLSGLAIQSAAQKSSELARQELGGSVTLQ VDRQKQMEKQQDSGEKRSFESTPIKVSDANKLAALDHVKSYNYTTSASANAGNFDAIESS SSSDSSSSSSSSNAKNSQGGGQGGPQMVQADLSIEGVISTALVDDFSDGDSKITDGRAIT KSDVGKKVTVINETLAEENDLSVGDSITIESATDEDTTVKLKIVGIYKTTSSGDDQAQNF SFLNPYNKLYTPYTATAALKGDDYKNTIDSAVYYMDDAKNMDTFVKAAKKTSIDFDTYTL NTNDQLYQQMVGPIENVASFSKNVVYLVSVAGAVILGLIVMMSIRERKYEMGVLMAIGEK RWKLIGQFLTEILIVAVIAIGLASVTGNLVANQLGNQLLSQQISSSTDSTQTASGQMPGG GGGMGGKMFGHSSSNVDVIDSLNVAVSMNDMLILGGIGILIAIIATLLPSISVLRLHPKT ILTKQE
Uniprot No.

Target Background

Database Links
Protein Families
ABC-4 integral membrane protein family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YclI and how is it classified among ABC transporters?

YclI is an uncharacterized ABC transporter permease in Bacillus subtilis, identified with the gene ID 938279 and UniProt ID P94412 . ABC transporters typically consist of four core domains: two nucleotide binding domains (NBDs) that hydrolyze ATP and two transmembrane domains (TMDs) that enable substrate transport across cell membranes . Based on structural characteristics, YclI functions as a transmembrane component (permease) of an ABC transporter system. ABC transporters in B. subtilis are classified into three main groups: importers (which require a substrate binding protein), exporters, and those with regulatory functions beyond substrate transport . Though YclI's precise classification remains unconfirmed, its permease designation suggests it forms part of the transmembrane domain critical for substrate translocation.

What expression patterns does YclI exhibit under different growth conditions?

While the specific expression patterns of YclI have not been directly addressed in the provided search results, insights can be drawn from studies of other ABC transporters in B. subtilis. Many ABC transporters show differential expression patterns depending on environmental conditions and growth phases. For instance, the YtrBCDEF ABC transporter system is induced in the presence of cell wall-targeting antibiotics such as ramoplanin, bacitracin, and vancomycin . YtrE specifically serves as a marker protein for inhibition of membrane-bound peptidoglycan biosynthesis steps . YtrBCDEF expression is also induced following cold shock exposure .

Research methodology to characterize YclI expression patterns would typically include:

  • Transcriptional reporter fusions (e.g., yclI-lacZ)

  • qRT-PCR analysis under various growth conditions

  • Ribosome profiling for translational regulation assessment

  • Proteomics approaches to quantify protein abundance

What is the genomic context of yclI in Bacillus subtilis?

The yclI gene (Gene ID: 938279) is annotated as an "ABC transporter permease" in Bacillus subtilis subsp. subtilis str. 168 . While the search results don't provide complete information about the genomic neighborhood, understanding genomic context is crucial for functional insights. ABC transporter genes in B. subtilis are typically organized in operons that include genes encoding the nucleotide-binding domain proteins, transmembrane domain proteins, and sometimes substrate-binding proteins or regulatory elements.

A thorough genomic context analysis would involve:

  • Identification of adjacent genes and their functional annotations

  • Analysis of potential operon structure through transcriptomic data

  • Examination of regulatory elements in the promoter region

  • Comparative genomics across related Bacillus species to identify conservation patterns

What methodologies are most effective for functional characterization of YclI?

Functional characterization of uncharacterized ABC transporters like YclI requires a multi-faceted approach. Based on established methodologies for ABC transporter research, the following experimental strategies are recommended:

Genetic Approaches:

  • Construction of clean deletion mutants (ΔyclI) using allelic replacement

  • Complementation studies with wild-type and mutated variants

  • Conditional expression systems to control YclI levels

  • Suppressor mutation screening to identify functional networks

Biochemical Characterization:

  • Membrane vesicle transport assays to measure substrate translocation

  • ATPase activity assays to quantify energy utilization

  • Protein purification and reconstitution in liposomes

  • Substrate binding assays using purified components

Structural Biology:

  • Cryo-electron microscopy for structural determination

  • X-ray crystallography of individual domains or full transporter

  • Molecular dynamics simulations to predict conformational changes

  • Cross-linking and mass spectrometry for identifying domain interactions

Physiological Assessment:

  • Phenotypic profiling under various stress conditions

  • Metabolomic analysis to identify accumulated substrates in mutants

  • Cell envelope integrity assays (e.g., sensitivity to detergents, osmotic stress)

  • Growth rate and competitive fitness assays

This comprehensive approach has proven successful for characterizing other ABC transporters in B. subtilis, such as BmrA and BmrCD, which were shown to transport various substrates including Hoechst 33342, ethidium bromide, and doxorubicin through inside-out membrane vesicle assays .

How might YclI contribute to antibiotic resistance in Bacillus subtilis?

While the specific role of YclI in antibiotic resistance is not directly addressed in the search results, several mechanisms by which ABC transporters confer resistance in B. subtilis have been documented, providing a framework for investigating YclI's potential contributions:

Potential Resistance Mechanisms:

MechanismDescriptionExample in B. subtilisMethodology to Test in YclI
Direct ExportActive efflux of antibiotics from the cellBmrA exports cervimycin C Inside-out vesicle transport assays with labeled antibiotics
Drug SensingDetection of antibiotics leading to resistance pathway activationBceAB-BceRS system senses bacitracin Transcriptional reporter assays monitoring stress response genes in ΔyclI
Target ProtectionBinding or modification of antibiotic targetsBceAB protects UPP from bacitracin Cell wall precursor analysis in presence of cell wall antibiotics
Indirect EffectAlteration of cell physiology reducing antibiotic efficacyYtrBCDEF affects peptidoglycan layer thickness Electron microscopy of cell envelope in yclI overexpression strains

To investigate YclI's role in antibiotic resistance, researchers should:

  • Perform minimum inhibitory concentration (MIC) assays with various antibiotics comparing wild-type and ΔyclI strains

  • Analyze transcriptomic responses to antibiotic exposure in presence/absence of YclI

  • Investigate potential interactions with known resistance determinants through genetic and biochemical approaches

  • Monitor the accumulation and efflux of fluorescently labeled antibiotics in cellular systems with modulated YclI expression

What role might YclI play in cell wall biosynthesis and homeostasis?

Several ABC transporters in B. subtilis influence cell wall processes, suggesting potential roles for YclI in this essential aspect of bacterial physiology. For example, overexpression of the YtrBCDEF ABC transporter leads to the production of a thicker peptidoglycan layer in B. subtilis . Additionally, the expression of the ytrGABCDEF operon is induced in the presence of cell wall-acting antibiotics such as ramoplanin, bacitracin, and vancomycin .

To investigate YclI's potential role in cell wall processes, researchers should consider:

Experimental Approaches:

  • Cell Wall Composition Analysis:

    • Peptidoglycan structural analysis in ΔyclI mutants

    • Quantification of wall teichoic acid content and composition

    • Measurement of lipid II cycle intermediates

  • Morphological Studies:

    • Electron microscopy to assess cell envelope ultrastructure

    • Fluorescence microscopy with cell wall-specific dyes

    • Cell shape and division pattern analysis

  • Interaction Studies:

    • Bacterial two-hybrid assays to identify interactions with cell wall synthesis enzymes

    • Co-immunoprecipitation of YclI with potential protein partners

    • Localization studies using fluorescent protein fusions

  • Physiological Tests:

    • Susceptibility to cell wall hydrolytic enzymes (e.g., lysozyme)

    • Osmotic stress resistance profiling

    • Cell lysis rates under various growth conditions

How can substrate specificity of YclI be experimentally determined?

Identifying the substrate(s) of uncharacterized transporters like YclI presents a significant challenge. Based on methodologies applied to other ABC transporters, the following approaches would be effective:

Direct Transport Assays:

  • Inside-out membrane vesicles containing overexpressed YclI

  • Purified YclI reconstituted in proteoliposomes

  • Whole-cell uptake/export assays with radiolabeled or fluorescent substrates

Indirect Approaches:

  • Metabolomic profiling comparing wild-type and ΔyclI strains

  • Growth phenotyping on various nutrient sources

  • Suppressor mutation analysis identifying compensatory pathways

Computational Methods:

  • Structural homology modeling to predict substrate binding pockets

  • Molecular docking simulations with potential substrates

  • Sequence-based substrate prediction using machine learning

Genetic Approaches:

  • Transcriptomic analysis under various growth conditions

  • Identification of co-regulated genes suggesting functional relationships

  • Heterologous expression in surrogate hosts with defined backgrounds

For example, the substrate specificity of the YtrBCDEF transporter was investigated through expression studies and growth phenotypes, leading to its proposed role in acetoin import . Similar methodologies could reveal YclI's substrate preference.

How does ATP hydrolysis couple to transport function in YclI-containing ABC transporter systems?

While specific information about YclI's ATP hydrolysis mechanism is not provided in the search results, understanding the general principles of ABC transporter energetics is crucial for characterizing this system. ABC transporters typically couple ATP binding and hydrolysis to conformational changes that drive substrate translocation.

To investigate this coupling in YclI-containing systems, researchers should consider:

Key Methodological Approaches:

Experimental ApproachInformation ProvidedTechnical Considerations
ATPase activity assaysQuantification of ATP hydrolysis ratesRequires purified components or membrane preparations
ATP binding assaysAffinity and stoichiometry of nucleotide bindingOften uses fluorescent ATP analogs or radiolabeled ATP
Mutagenesis of conserved motifsIdentification of critical residues for functionFocus on Walker A/B motifs and signature sequence
Conformational change monitoringDetection of structural rearrangements during transport cycleFRET, EPR spectroscopy, or limited proteolysis approaches
Transport-ATPase coupling ratioEfficiency of energy utilizationSimultaneous measurement of ATP hydrolysis and substrate transport

For example, studies with the B. subtilis multidrug transporter BmrCD demonstrated ATP-dependent transport of substrates like Hoechst 33342 and ethidium bromide into reconstituted vesicles, and this transport activity could be inhibited by orthovanadate, an ATPase inhibitor . Similar approaches would be valuable for characterizing YclI's energy coupling mechanism.

How might understanding YclI function contribute to antimicrobial development?

ABC transporters represent potential targets for antimicrobial development due to their essential roles in bacterial physiology and virulence. Understanding YclI's function could contribute to this field in several ways:

  • If YclI functions in antibiotic resistance: Inhibitors could serve as adjuvants to enhance antibiotic efficacy

  • If YclI transports essential nutrients: Blocking its function could starve bacteria of critical resources

  • If YclI participates in cell wall processes: Targeting it could disrupt cell envelope integrity

Research methodologies to explore YclI as an antimicrobial target would include:

  • High-throughput screening for inhibitors of YclI function

  • Structure-based drug design targeting critical domains

  • Combination therapy approaches with existing antibiotics

  • Assessment of resistance development against YclI-targeting compounds

What comparative insights can be gained by studying YclI homologs across bacterial species?

Comparative analysis of YclI homologs across diverse bacteria can provide valuable insights into its evolutionary conservation, functional importance, and specialization. Methodological approaches include:

  • Phylogenetic Analysis:

    • Construction of phylogenetic trees to map evolutionary relationships

    • Identification of conserved and variable regions suggesting functional domains

    • Assessment of selection pressures on different protein regions

  • Functional Complementation:

    • Cross-species complementation experiments to test functional conservation

    • Heterologous expression studies to assess substrate specificity differences

    • Domain-swapping experiments to identify species-specific functional elements

  • Genomic Context Analysis:

    • Examination of operon structure conservation across species

    • Identification of co-evolved gene clusters suggesting functional relationships

    • Analysis of regulatory elements governing expression

For instance, phylogenetic analysis revealed that BceAB-like transporters are nearly exclusively found in bacteria of the phylum Firmicutes and confer resistance to specific antimicrobials . Similar analysis of YclI could reveal its distribution and potential specialization across bacterial taxa.

How does YclI expression change during different growth phases and stress conditions?

Understanding the regulation of YclI expression provides insights into its physiological roles. While specific data for YclI is not provided in the search results, studies of other ABC transporters in B. subtilis demonstrate condition-dependent expression patterns.

Methodological Approaches:

  • Transcriptional Profiling:

    • RNA-seq across growth phases and stress conditions

    • Promoter-reporter fusion assays to monitor expression dynamics

    • Identification of transcription factor binding sites

  • Proteomics:

    • Quantitative proteomics to measure protein abundance changes

    • Pulse-chase experiments to determine protein turnover rates

    • Post-translational modification analysis

  • Regulation Mechanism Studies:

    • Identification of transcriptional regulators through genetic screens

    • Chromatin immunoprecipitation to confirm direct regulatory interactions

    • Analysis of regulatory small RNAs affecting expression

For example, the genes encoding the BmrCD transporter are induced in the presence of various antibiotics, particularly those targeting ribosomes . The YtrBCDEF system is induced by cell wall-acting antibiotics and cold shock . Similar studies of YclI expression would reveal its regulatory patterns and potential functional roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.