Recombinant Bacillus subtilis Uncharacterized glycosyltransferase ykoT (ykoT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ykoT; BSU13390; Uncharacterized glycosyltransferase YkoT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ykoT
Target Protein Sequence
MKQSQPVLTIVVPCFNEEEVFQETSHQLTEVVDDLIEEKLIAEDSKILFVDDGSKDRTWA LIAMESIRNKKVTGLKLACNVGHQKALLAGLHKAKNRSDCVISIDADLQDDISVIRDFML KYHEGCEIVYGVRRSRKTDTFFKRTTALGFYRLMNKLGIKLIYNHADFRLMNKRSLEELE RYPEANLFLRGIVPMIGFKSAEVLYDRKERFAGKTKYPLKKMLSFAFNGITSFSVAPIRF FTLLGFVLFFLSAVAGIGAFIQKLLGHTNAGWASLIISIWFLGGLQLMGIGIIGEYIGTI FSEVKRRPKYAIDIDLYNEQLSPLQRQEKERLEKKYS
Uniprot No.

Target Background

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YkoT and what is its function in Bacillus subtilis?

YkoT is a GT-A fold family 2 glycosyltransferase found in Bacillus subtilis that transfers sugar moieties from nucleotide-activated sugars (such as UDP-glucose, UDP-GlcNAc, or UDP-galactose) to various substrates. It is encoded in an operon with a second gene, ykoS, which shows similarities to members of the GT-C family glycosyltransferases. YkoT is involved in lipoteichoic acid (LTA) glycosylation processes in B. subtilis, although its precise role is still being characterized .

What is the genetic context of ykoT in the B. subtilis genome?

Analysis of the genomic region shows that ykoT is encoded in an operon with a second gene, ykoS. While YkoT belongs to the GT-A fold family 2 glycosyltransferases, YkoS shows similarities to members of the GT-C family glycosyltransferases, which are characterized by 8–13 transmembrane helices and a DXD or modified (DXE, EXD, DDX, or DEX) motif in an extracellular loop. This operon arrangement suggests potential functional cooperation between these two glycosyltransferases in cell wall synthesis processes .

What expression systems are recommended for recombinant YkoT production?

For recombinant production of YkoT, E. coli expression systems are commonly used due to their high yield and established protocols. When expressing YkoT with a His-tag, BL21(DE3) or similar strains can be employed with IPTG induction. For projects requiring post-translational modifications more similar to those in Bacillus, yeast expression systems may be preferable. Both systems have been successfully used for the expression of Bacillus proteins, with purity levels of >80% as determined by SDS-PAGE analysis .

What are the optimal conditions for storing recombinant YkoT protein?

Recombinant YkoT protein should be stored in PBS buffer. For short-term storage (days to weeks), +4°C is sufficient. For long-term preservation, storage at -20°C to -80°C is recommended. If using the lyophilized form, the protein should be reconstituted in the appropriate buffer immediately before use. These storage conditions help maintain protein stability and enzymatic activity over time .

How can the purity and activity of recombinant YkoT be assessed?

The purity of recombinant YkoT can be assessed using SDS-PAGE, with typical preparations achieving >80% purity. Endotoxin levels should be measured using the LAL method, with acceptable levels being <1.0 EU per μg of protein. For activity assessment, glycosyltransferase assays measuring the transfer of radioactively labeled or fluorescently tagged sugar moieties from nucleotide-activated sugars to appropriate acceptor substrates can be performed. Circular dichroism (CD) spectroscopy can be used to confirm proper protein folding, which is essential for enzymatic activity .

What methods can be used to study YkoT's glycosyltransferase activity?

To study YkoT's glycosyltransferase activity, researchers can employ several approaches:

  • In vitro enzymatic assays: Using purified recombinant YkoT with appropriate sugar donors (UDP-glucose, UDP-GlcNAc) and acceptor substrates, followed by chromatographic separation and detection of reaction products.

  • Radiolabeled substrate incorporation: Measuring the transfer of 14C or 3H-labeled sugars to acceptor molecules.

  • Western blot analysis: To detect changes in LTA glycosylation patterns in wild-type versus ykoT deletion strains.

  • NMR spectroscopy: To characterize specific glycosylation products and their chemical structures.

These methods allow for detailed characterization of substrate specificity, kinetic parameters, and the influence of reaction conditions on enzymatic activity .

How can genetic knockout studies be designed to investigate YkoT function?

To design effective genetic knockout studies for investigating YkoT function:

  • Gene replacement strategy: Replace the ykoT gene in B. subtilis with an antibiotic resistance marker using homologous recombination techniques.

  • Confirmation of deletion: Verify successful gene deletion using PCR and sequencing to ensure complete removal of the target gene.

  • Phenotypic analysis: Assess changes in LTA structure using anti-LTA western blot analysis on cell extracts derived from wild-type and mutant B. subtilis strains.

  • Complementation studies: Reintroduce the ykoT gene (and potentially its operon partner ykoS) under control of its native promoter at a neutral locus (such as amyE) to confirm that observed phenotypes are directly related to ykoT deletion.

  • Site-directed mutagenesis: Create point mutations in catalytic residues to analyze structure-function relationships.

This systematic approach allows for comprehensive evaluation of YkoT's role in cellular processes .

What techniques can determine the substrate specificity of YkoT?

Determining YkoT substrate specificity requires multiple complementary approaches:

  • In vitro screening with diverse nucleotide-activated sugars: Test UDP-glucose, UDP-GlcNAc, UDP-galactose, and other potential sugar donors using purified recombinant protein.

  • Mass spectrometry analysis: Identify specific sugar moieties transferred by YkoT and their linkages to acceptor molecules.

  • Structural analysis of glycosylated products: Use NMR to characterize the precise chemical nature of the glycosidic bonds formed.

  • Competition assays: Measure enzyme activity with mixed substrates to determine preferential usage.

  • Molecular docking and simulation: Predict substrate binding sites and interaction energies.

These methodologies collectively provide a comprehensive profile of YkoT substrate preferences and reaction mechanisms .

How does YkoT contribute to B. subtilis cell wall synthesis and stress responses?

YkoT's role in B. subtilis cell wall synthesis appears to involve lipoteichoic acid (LTA) glycosylation, though the specifics differ from other glycosyltransferases like CsbB. When investigating stress responses, researchers should examine:

  • Growth under varying conditions: Compare wild-type and ykoT mutant strains under different stressors (osmotic, temperature, antibiotics) to identify condition-specific phenotypes.

  • Secretion stress analysis: Monitor protein secretion efficiency in ykoT deletion strains, as alterations in cell wall composition may affect the protein secretion machinery.

  • Transcriptomic profiling: Measure changes in gene expression patterns during stress responses to identify regulatory connections between ykoT and stress response pathways.

  • Cell morphology examination: Use electron microscopy to detect structural changes in the cell envelope that may result from altered glycosylation patterns.

These investigations help establish connections between YkoT function and bacterial adaptation mechanisms .

What strategies can improve recombinant YkoT production for structural studies?

For structural studies requiring high-quality recombinant YkoT:

  • Expression optimization: Test multiple expression vectors, promoter strengths, and induction conditions to maximize protein yield while maintaining proper folding.

  • Fusion tag selection: Compare His-tag with alternative tags (MBP, GST, SUMO) to identify constructs with improved solubility and stability.

  • Co-expression with chaperones: Introduce molecular chaperones (GroEL/GroES, DnaK/DnaJ) to facilitate proper protein folding during expression.

  • Detergent screening: For membrane-associated studies, test multiple detergents to identify optimal conditions for protein extraction and purification.

  • Engineering the bacterial host: Consider deletions of proteolytic enzymes in the expression host to enhance stability of secreted proteins, as demonstrated in B. subtilis secretion stress studies.

  • Genome reduction approaches: Implement targeted genome reduction of the expression host to eliminate counterproductive processes and enhance protein production.

These strategies address common challenges in producing sufficient quantities of properly folded YkoT for crystallization or cryo-EM studies .

What are the most effective approaches for studying interactions between YkoT and YkoS?

To study the functional relationship between YkoT and YkoS (encoded in the same operon):

  • Co-immunoprecipitation: Use tagged versions of YkoT and YkoS to detect physical interactions between these proteins.

  • Bacterial two-hybrid system: Employ complementary fragments of a reporter protein fused to YkoT and YkoS to assess protein-protein interactions in vivo.

  • Co-expression and co-purification: Express both proteins simultaneously and attempt co-purification to identify stable complex formation.

  • Comparative phenotyping: Create single and double knockout strains (ΔykoT, ΔykoS, and ΔykoT-ykoS) to assess whether phenotypes are enhanced in the double mutant, suggesting functional cooperation.

  • Domain swapping experiments: Create chimeric proteins with domains from each protein to identify interaction regions.

These methods can reveal whether YkoT and YkoS function independently or as part of a glycosylation complex in B. subtilis .

What are common challenges in expressing and purifying active YkoT protein?

Researchers commonly encounter several challenges when working with recombinant YkoT:

  • Protein solubility issues: YkoT may form inclusion bodies during overexpression. To address this:

    • Reduce expression temperature to 16-18°C

    • Use lower IPTG concentrations for induction

    • Test solubility-enhancing fusion tags

    • Include osmolytes or mild detergents in lysis buffers

  • Activity loss during purification: To preserve enzymatic activity:

    • Include glycerol (10-20%) in all buffers

    • Add reducing agents like DTT or β-mercaptoethanol

    • Minimize freeze-thaw cycles

    • Consider including substrate analogs for stabilization

  • Inconsistent yields: For more consistent production:

    • Standardize growth conditions and harvest times

    • Use autoinduction media to reduce variability

    • Consider custom production services for consistent quality

These strategies address common technical obstacles in obtaining functional recombinant YkoT protein .

How can contradictory results between in vitro and in vivo YkoT studies be reconciled?

When facing discrepancies between in vitro activity and in vivo phenotypes:

  • Context-dependent functionality: YkoT's function may depend on cellular context and partners. Investigate by:

    • Comparing purified enzyme activities with crude cell lysates

    • Reconstituting in vitro systems with multiple cellular components

    • Testing activity under various buffer conditions mimicking cellular environments

  • Redundancy in function: B. subtilis may have redundant glycosyltransferases. Address by:

    • Creating multiple knockout strains (double, triple mutants)

    • Performing complementation studies with related glycosyltransferases

    • Conducting conditional knockouts to bypass potential developmental effects

  • Methodology validation: Confirm experimental approaches by:

    • Using positive and negative controls for all assays

    • Validating antibody specificity in western blot analyses

    • Employing multiple independent methods to measure the same outcome

This systematic approach helps identify context-dependent factors influencing YkoT function .

What quality control methods ensure reproducible results when working with recombinant YkoT?

To ensure reproducible results when working with recombinant YkoT, implement the following quality control measures:

Quality Control ParameterMethodAcceptance Criteria
Protein puritySDS-PAGE>80% single band
Endotoxin levelsLAL method<1.0 EU per μg protein
Protein identityMass spectrometryMatches predicted mass
Structural integrityCircular dichroismConsistent secondary structure
Enzymatic activityGlycosyltransferase assayActivity within 20% of reference
Batch consistencyLot-to-lot comparison<15% variation in specific activity
Storage stabilityActivity monitoring over time<10% activity loss per month at -80°C

Additionally, maintain detailed records of expression conditions, purification protocols, and buffer compositions to facilitate troubleshooting and ensure consistency across experiments. Implement regular calibration of equipment used for protein characterization to minimize instrumental variation .

How is systems biology being applied to understand YkoT function in the context of B. subtilis metabolism?

Systems biology approaches offer comprehensive insights into YkoT's role within the broader B. subtilis metabolic network:

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data from wild-type and ykoT mutant strains to identify affected pathways and regulatory networks.

  • Flux analysis: Use 13C-labeled substrates to track metabolic flux changes resulting from ykoT deletion, particularly focusing on cell wall precursor biosynthesis.

  • Protein-protein interaction networks: Employ techniques like BioID or proximity labeling to identify the YkoT interactome under different growth conditions.

  • Mathematical modeling: Develop computational models that incorporate YkoT activity into larger metabolic networks to predict cellular responses to perturbations.

  • Genome reduction studies: Investigate YkoT function in minimal genome B. subtilis strains to understand its essentiality in different genetic backgrounds.

These approaches help position YkoT within the complex metabolic landscape of B. subtilis and may reveal unexpected connections to other cellular processes .

What are emerging applications of engineered YkoT variants in biotechnology?

Engineered YkoT variants present several promising biotechnological applications:

  • Custom glycosylation: Engineer YkoT to accept non-native sugar donors for the synthesis of novel glycoconjugates with potential pharmaceutical applications.

  • Enhanced protein secretion: Modify YkoT to optimize cell wall properties for improved protein secretion in B. subtilis expression systems.

  • Biosensor development: Create YkoT variants with fluorescent tags that respond to specific cellular conditions, providing real-time monitoring of glycosylation processes.

  • Enzyme immobilization: Develop methods to attach modified YkoT to solid supports for continuous biocatalytic production of specialized glycosides.

  • Cell surface engineering: Use YkoT to modify the bacterial cell surface for improved biofilm formation, bioremediation, or vaccine development.

These applications leverage the glycosyltransferase activity of YkoT while extending its utility beyond its native function .

How do environmental factors influence YkoT expression and activity in B. subtilis?

Environmental factors significantly impact YkoT expression and activity:

  • Stress response regulation: Investigate transcriptional changes in ykoT expression under various stressors (osmotic, pH, temperature, antibiotics) using qRT-PCR or reporter gene fusions.

  • Nutrient availability effects: Examine how carbon source availability and limitations affect ykoT expression and subsequent glycosylation patterns.

  • Growth phase dependence: Compare YkoT activity during different growth phases (exponential, stationary) to identify temporal regulation patterns.

  • Biofilm-specific regulation: Assess differences in YkoT function between planktonic cells and biofilm communities.

  • Host-microbe interactions: For strains isolated from natural environments, study how host-derived signals modulate YkoT expression and function.

Understanding these regulatory mechanisms provides insights into how B. subtilis adapts its cell wall structure to different environmental conditions through glycosyltransferase activity modulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.