Recombinant Bacillus subtilis Uncharacterized HTH-type transcriptional regulator ytdP (ytdP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ytdP; BSU30150; Uncharacterized HTH-type transcriptional regulator YtdP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-772
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ytdP
Target Protein Sequence
MGGFMKRSQYKFYYKLITFFCLLSTIPVILVGLFSYEHSQKTAISNVSEEKFDTLQQTQQ SIEHILKTVDHSLTHYVSSPPLLRTLSEPLHSDQFQIYNQVNQELNYLQSFDTDLSNMTL VSYTKKWYMNNSGLYRLNTDTLHEAASAYTKQKASRSYWTLEENNHLISTKEGTAENCRY NINLIKQLPLNSTNTKGLAAASIPSCSLVKNMPGYSNANNLFIIDEKGLIILHNNMSDVG ESLHNDGFVQKVLAQTANSGQFETVIDRIHYKVTYQKSDYNAWTYFSLVSLPELKKEAKS IGWITFAVCLILLTLSLLFSWLGSRHFYKPIRVLYESFARHGAIQEKQQPPQNEFELIEQ SFKQLKDRNDDLEETMKQQATHLQQYFMVRLMLGKLTDEEVDNRFESLGLKQNWRHLALL VLQIDTLNHTPYEKKDMDLLLFAVNSLIERNIPTDKHLAPAVVDKQQATILINQSGTKEE FMAELNETARMIQEKAEAELQLSVSIGISQPFDVLTKAKTAYAEGSEALKYRLKAENKSI IFYEDLDQKKTFKTHFPKQLQHELFDAVKAGDKEKADKCLHAILQAIFTQNTNPYQFQIA IARFLNHVIELMHVLGIELFELEENKMLYDQIFELKTFEDTENWLKNEFIDPMTDKVNAR ADAQYKNISDNIIHIIHHEFESELTLDEIARRLHYNPNYLSSIFKKEMGISFSEYVSSYR HHMAKSWLAETDMAVKDIAEKLKYKNSQNFIRSFKKLEGITPGNYRQQKRSM
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ytdP and how does it fit into the B. subtilis transcriptional regulatory network?

ytdP is an uncharacterized helix-turn-helix (HTH) type transcriptional regulator in Bacillus subtilis. While specific information on ytdP is limited, it likely functions as part of the complex transcriptional regulatory network (TRN) of B. subtilis that controls gene expression in response to environmental conditions. B. subtilis uses extensive gene regulation networks to control cell growth, function, and responses to environmental challenges . Researchers can study ytdP within this context by employing network component analysis and model selection approaches similar to those used to map other B. subtilis regulatory interactions . Experimental designs might include transcriptome analysis under various conditions to detect potential regulatory relationships between ytdP and other genes.

What experimental approaches can be used to confirm ytdP is a functional transcriptional regulator?

To confirm ytdP functions as a transcriptional regulator, researchers should consider a multi-step approach:

  • DNA-binding assays: Electrophoretic mobility shift assays (EMSA) or DNase footprinting to confirm DNA-binding capability

  • Reporter gene assays: Construct promoter-reporter fusions to measure transcriptional activity in the presence/absence of ytdP

  • ChIP-exo/ChIP-seq: This technique has been successfully used to identify binding sites for uncharacterized transcription factors in bacteria

  • Transcriptome analysis: RNA-seq comparing wild-type and ytdP deletion mutants to identify differentially expressed genes

A similar methodological pipeline has been successfully implemented for other transcription factors, with ChIP-exo providing particularly valuable data on binding sites and potential regulatory targets .

What expression systems are optimal for producing recombinant ytdP protein?

Based on protocols used for other B. subtilis proteins, the following expression system is recommended:

Expression system design:

  • Vector: pET28a(+) with N-terminal 6xHis-tag (similar to the approach used for YtpP)

  • Host: E. coli BLR(DE3) for efficient protein expression

  • Induction: IPTG-inducible system with optimization of temperature and induction time

Purification protocol:

  • Affinity chromatography using Ni-NTA resin

  • Size exclusion chromatography for further purification

  • Analysis by SDS-PAGE to confirm purity

Small-scale expression tests should be conducted to determine optimal protein expression conditions as was done for YtpP . Testing multiple expression conditions (temperature, inducer concentration, and induction time) is crucial for maximizing soluble protein yield.

How can researchers begin characterizing an uncharacterized transcriptional regulator like ytdP?

Initial characterization should follow a systematic approach:

  • Sequence analysis: Identify conserved domains, particularly the HTH motif, and compare with characterized transcription factors

  • Structural prediction: Use tools like AlphaFold to predict protein structure

  • Phylogenetic analysis: Determine evolutionary relationships with characterized transcription factors

  • Expression pattern analysis: Determine when and under what conditions ytdP is expressed

  • Knockout studies: Generate a ytdP deletion strain and analyze phenotypic changes

Gene deletion studies have been particularly valuable for understanding the biological roles of uncharacterized transcription factors, as demonstrated in studies of other bacterial regulators .

What growth conditions might trigger ytdP expression or activity in B. subtilis?

To determine conditions triggering ytdP expression or activity, researchers should design experiments examining various physiological states and stresses:

Growth ConditionMeasurement TechniqueExpected Outcome
Standard LB mediumqRT-PCR, Western blotBaseline expression
Nutrient limitationRNA-seq, proteomicsPotential upregulation
Heat/cold shockqRT-PCR, reporter assaysStress response
Oxidative stressTranscriptomicsPotential regulatory role
Sporulation phasesTime-course analysisDevelopmental regulation

This approach is supported by studies on B. subtilis that examined an entire life cycle from spore germination to sporulation with samples collected at 30-minute intervals, as well as stress responses and biofilm formation . For ytdP specifically, researchers should monitor expression and activity across these conditions to identify its regulatory context.

What high-throughput methodologies can identify the DNA binding motif and genomic targets of ytdP?

Several complementary methodologies can effectively identify ytdP binding sites:

ChIP-exo analysis: This technique provides higher resolution than traditional ChIP-seq and has been successfully used to characterize uncharacterized transcription factors . The protocol involves:

  • Cross-linking proteins to DNA in vivo

  • Immunoprecipitation using anti-ytdP antibodies or epitope tags

  • Exonuclease treatment to trim DNA to precise binding sites

  • High-throughput sequencing and computational motif discovery

DAP-seq (DNA Affinity Purification sequencing):

  • Incubate purified recombinant ytdP with fragmented genomic DNA

  • Capture protein-DNA complexes and sequence bound DNA

  • Computational analysis to identify enriched sequence motifs

Integrative analysis with transcriptomics:
Combine binding data with RNA-seq from ytdP mutants to distinguish direct from indirect regulatory effects, similar to the approach used for other transcriptional regulatory networks .

How can protein-protein interactions involving ytdP be comprehensively mapped?

To map protein-protein interactions involving ytdP, researchers should employ:

Yeast two-hybrid (Y2H) screening:
Following the methodology used for other B. subtilis proteins , researchers can:

  • Use ytdP as bait in a Y2H system against a B. subtilis genomic library

  • Screen for positive interactions using selective media (SC-LUH and SC-LUA)

  • Validate interactions through specificity assays to eliminate false positives

  • Confirm interactions using independent methods

This approach has proven effective for constructing networks of high biological significance for other B. subtilis proteins .

In vivo pull-down assays:

  • Express epitope-tagged ytdP in B. subtilis

  • Perform immunoprecipitation followed by mass spectrometry

  • Compare results with control samples to identify specific interactors

Bacterial two-hybrid system:
This system may provide more physiologically relevant results for bacterial proteins than Y2H screens.

What computational approaches can predict ytdP regulon membership and function?

Advanced computational approaches can provide insights into the ytdP regulon:

Network component analysis (NCA):
This technique can estimate transcription factor activities and learn expanded transcriptional regulatory networks . Applied to ytdP, researchers could:

  • Collect transcriptomics data across multiple conditions

  • Use NCA to infer ytdP activity patterns

  • Predict regulatory connections based on correlation with gene expression

  • Validate predictions experimentally

Machine learning algorithms:
Train models on known transcription factor binding sites to predict potential ytdP binding sites genome-wide.

Comparative genomics:

  • Identify ytdP orthologs in related species

  • Analyze conservation of adjacent genes and potential binding sites

  • Infer functional relationships based on genomic context

These computational approaches have successfully expanded our understanding of B. subtilis transcriptional networks, identifying thousands of novel regulatory interactions with high accuracy rates (~62%) .

How does post-translational modification affect ytdP function?

Potential post-translational modifications of ytdP and their effects can be investigated through:

Phosphorylation analysis:
Given the importance of protein-tyrosine phosphorylation in B. subtilis regulation , researchers should:

  • Perform phosphoproteomic analysis to detect phosphorylated residues

  • Create phosphomimetic and phosphoablative mutations

  • Compare DNA binding and regulatory activity between variants

  • Identify kinases and phosphatases acting on ytdP

CoAlation analysis:
Recent research has identified protein CoAlation as a regulatory mechanism in B. subtilis . Researchers can:

  • Test if ytdP is subject to CoAlation under oxidative stress

  • Investigate if CoAlation affects DNA binding or protein-protein interactions

  • Determine if enzymes like YtpP or TrxA are involved in modification of ytdP

Mass spectrometry techniques:
Use high-resolution mass spectrometry to identify all post-translational modifications and their stoichiometry under different conditions.

How can cross-regulatory relationships between ytdP and other transcription factors be determined?

To map the position of ytdP within the transcriptional hierarchy of B. subtilis:

Sequential ChIP (ChIP-reChIP):
This technique can identify genomic regions co-occupied by ytdP and other transcription factors.

Transcriptome analysis of combinatorial mutants:

  • Generate single and double mutants of ytdP and other transcription factors

  • Perform RNA-seq to identify synergistic, antagonistic, or independent effects

  • Construct regulatory networks based on genetic interactions

Protein-protein interaction mapping:
Use approaches like those described in section 2.2 to identify direct interactions between ytdP and other transcription factors.

Systems-level network modeling:
Integrate data from multiple experiments to position ytdP within the global regulatory network of B. subtilis, similar to previous network reconstruction efforts that successfully predicted thousands of novel regulatory interactions.

What are the best protocols for generating a ytdP deletion mutant in B. subtilis?

A detailed protocol for generating a ytdP deletion mutant includes:

Materials required:

  • PCR primers designed to amplify regions flanking ytdP

  • Antibiotic resistance cassette

  • B. subtilis competent cells

  • Selection media

Methodology:

  • Design PCR primers to amplify ~1kb regions upstream and downstream of ytdP

  • Create a fusion PCR product where ytdP is replaced by an antibiotic resistance marker

  • Transform B. subtilis competent cells with the linear DNA construct

  • Select transformants on appropriate antibiotic media

  • Verify deletion by PCR and sequencing

  • Perform complementation assays to confirm phenotypes are due to ytdP deletion

Phenotypic analysis:
Examine growth characteristics, morphology, stress resistance, and specific phenotypes under various conditions using microscopy techniques as described for other B. subtilis studies .

How can researchers develop specific antibodies against ytdP for immunological studies?

Development of anti-ytdP antibodies requires:

Antigen preparation:

  • Express and purify recombinant ytdP protein with N-terminal His-tag using a pET28a(+) vector system

  • Alternatively, identify immunogenic peptides within ytdP sequence for synthetic peptide antibody production

Immunization and antibody production:

  • Immunize rabbits or other suitable animals with purified ytdP

  • Collect antisera and purify IgG fraction

  • Perform affinity purification using immobilized ytdP protein

Validation of antibody specificity:

  • Western blot comparing wild-type and ytdP deletion strains

  • Immunoprecipitation followed by mass spectrometry

  • Immunofluorescence microscopy to confirm subcellular localization

High-quality antibodies are essential for techniques like ChIP-exo that have been successfully used to characterize other transcription factors .

What approaches can resolve contradictory data regarding ytdP function?

When faced with contradictory data, researchers should:

Methodological troubleshooting:

  • Examine differences in experimental conditions between studies

  • Verify strain backgrounds and potential secondary mutations

  • Assess specificity of reagents and potential cross-reactivity

Integrative analysis:

  • Combine multiple data types (genomics, transcriptomics, proteomics)

  • Weight evidence based on methodological rigor

  • Consider condition-specific effects that may explain apparent contradictions

Collaborative validation:
Establish collaborations between labs with contradictory results to perform side-by-side experiments with standardized protocols.

Genetic context analysis:
Investigate genetic interactions that might suppress or enhance ytdP phenotypes in different strain backgrounds.

How can ytdP characterization contribute to our understanding of B. subtilis gene regulation networks?

Characterizing ytdP would contribute to the B. subtilis regulatory network model by:

  • Filling gaps in the current transcriptional regulatory network model

  • Potentially identifying novel regulatory mechanisms

  • Providing insights into condition-specific regulation

  • Expanding our understanding of HTH-type regulator functions

Studies have shown that even well-studied organisms have incomplete regulatory networks, with many transcription factors remaining uncharacterized . Each newly characterized regulator like ytdP adds critical details to the global regulatory model, helping to explain how bacteria coordinate complex responses to environmental changes .

What high-throughput screening methods can identify conditions where ytdP activity is critical?

To identify conditions where ytdP plays a crucial role:

Phenotype MicroArrays:

  • Compare growth and metabolic activity of wild-type and ytdP mutant strains across hundreds of conditions

  • Identify conditions where significant differences occur

  • Validate findings with targeted experiments

Transposon sequencing (Tn-seq):

  • Generate transposon libraries in wild-type and ytdP deletion backgrounds

  • Subject libraries to various stresses or growth conditions

  • Sequence and compare to identify genetic interactions specific to each condition

Competitive fitness assays:
Co-culture wild-type and ytdP mutant strains (differentially labeled) under various conditions and track population dynamics over time.

These high-throughput approaches have proven effective for identifying condition-specific roles of regulatory proteins in bacteria.

How can structural characterization of ytdP inform its regulatory mechanism?

Structural studies of ytdP would provide critical insights:

X-ray crystallography or Cryo-EM:

  • Determine the three-dimensional structure of ytdP alone

  • Solve structures of ytdP bound to target DNA sequences

  • Analyze structural changes upon binding to effector molecules

NMR spectroscopy:

  • Investigate the dynamics of ytdP-DNA interactions

  • Study structural changes in response to potential ligands

  • Identify flexible regions important for protein-protein interactions

In silico molecular dynamics:

  • Simulate ytdP interactions with DNA and other proteins

  • Predict effects of mutations on structure and function

  • Model potential allosteric mechanisms

Structural insights would reveal the molecular basis of ytdP's specificity and regulatory mechanism, informing the design of mutations to test functional hypotheses.

What is the evolutionary conservation of ytdP across Bacillus species and related genera?

Evolutionary analysis of ytdP should include:

Comparative genomics:

  • Identify ytdP orthologs across Bacillus species and related genera

  • Analyze sequence conservation, particularly within the HTH domain

  • Examine genomic context conservation

Phylogenetic analysis:

  • Construct phylogenetic trees of ytdP and related transcription factors

  • Compare with species phylogeny to identify potential horizontal gene transfer events

  • Identify clades with potentially specialized functions

Functional conservation testing:

  • Express ytdP orthologs from different species in a B. subtilis ytdP mutant

  • Test for complementation of phenotypes

  • Identify species-specific functional differences

This evolutionary perspective would provide context for understanding ytdP's role within the broader bacterial transcriptional regulatory landscape.

How can single-cell techniques reveal heterogeneity in ytdP activity within a B. subtilis population?

Single-cell analysis of ytdP activity can be achieved through:

Fluorescent reporter systems:

  • Construct transcriptional fusions between ytdP-regulated promoters and fluorescent proteins

  • Image single cells using fluorescence microscopy techniques similar to those described for other B. subtilis proteins

  • Quantify fluorescence intensities to measure gene expression at the single-cell level

Single-cell RNA-seq:

  • Isolate single B. subtilis cells using microfluidics or flow cytometry

  • Perform single-cell RNA-seq to measure transcriptomes

  • Analyze cell-to-cell variability in ytdP-regulated genes

Time-lapse microscopy:

  • Monitor reporter gene expression in individual cells over time

  • Correlate ytdP activity with cellular events (division, sporulation)

  • Identify potential triggers for ytdP activation at the single-cell level

These techniques would reveal whether ytdP contributes to phenotypic heterogeneity within bacterial populations, an important factor in bacterial adaptation and survival.

What CRISPR-based approaches can facilitate ytdP functional studies?

CRISPR technologies offer powerful tools for ytdP research:

CRISPR interference (CRISPRi):

  • Design sgRNAs targeting the ytdP promoter or coding sequence

  • Express catalytically inactive Cas9 (dCas9) for transcriptional repression

  • Create tunable or inducible systems for temporal control of ytdP expression

CRISPR-based base editing:

  • Introduce specific point mutations in ytdP without double-strand breaks

  • Create variants with altered DNA binding, dimerization, or ligand binding

  • Study the effects of specific amino acid changes on ytdP function

CRISPRa (CRISPR activation):

  • Target transcriptional activators to the ytdP promoter

  • Study the effects of ytdP overexpression

  • Identify genes affected by increased ytdP activity

These CRISPR-based approaches allow precise genetic manipulation to dissect ytdP function with minimal disruption to the genomic context.

How can researchers investigate potential small molecule ligands that modulate ytdP activity?

To identify and characterize small molecule interactions with ytdP:

Thermal shift assays:

  • Monitor protein thermal stability in the presence of potential ligands

  • Screen compound libraries for molecules that alter ytdP stability

  • Validate hits with orthogonal binding assays

Surface plasmon resonance (SPR):

  • Immobilize ytdP on sensor chips

  • Measure binding kinetics with potential ligands

  • Determine binding affinities and association/dissociation rates

Metabolomic profiling:

  • Compare metabolomes of wild-type and ytdP mutant strains

  • Identify metabolites that accumulate or diminish in the absence of ytdP

  • Test candidate metabolites for direct binding to ytdP

Structural studies with bound ligands: Determine crystal structures or use NMR to characterize ytdP-ligand complexes and identify binding pockets and interaction mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.