Recombinant Bacillus subtilis Uncharacterized lipoprotein yfjD (yfjD)

Shipped with Ice Packs
In Stock

Description

Key Features

ParameterDescriptionSource
Gene NameyfjD
SynonymsBSU08140; Uncharacterized lipoprotein YfjD
UniProt IDO31555
Protein LengthFull-length mature protein (30–185 amino acids)
TagN-terminal His-tag
Expression HostE. coli
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0

Recombinant Expression

The protein is produced via bacterial fermentation in E. coli, followed by purification under denaturing conditions. While B. subtilis is a common host for recombinant proteins due to its secretion efficiency and GRAS status , yfjD is expressed in E. coli to leverage its rapid growth and cost-effectiveness.

Key Production Steps

  1. Cloning: The yfjD gene is inserted into an E. coli expression vector with an N-terminal His-tag for affinity chromatography.

  2. Induction: Protein expression is induced (e.g., via IPTG), followed by bacterial lysis.

  3. Purification: His-tagged protein is purified using nickel affinity chromatography, yielding >90% purity .

Experimental Applications

ApplicationDescriptionSource
ELISA AssaysDetection of anti-yfjD antibodies in sera or lysates using recombinant protein-coated plates .
Structural StudiesCrystallization or NMR studies to elucidate tertiary structure and interactions.
Functional ScreensHigh-throughput assays to identify binding partners or enzymatic activities.

Hypothetical Roles

  • Immune Modulation: Lipoproteins in Bacillus species often interact with host immune cells, suggesting yfjD may influence pathogen recognition.

  • Membrane Integrity: Lipoproteins anchor to membranes, potentially stabilizing bacterial cell walls.

Recommendations

ParameterGuidelineSource
Storage-20°C/-80°C (long-term), 4°C (short-term aliquots)
ReconstitutionLyophilized powder dissolved in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol
StabilityAvoid repeated freeze-thaw cycles; store in airtight containers.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To request a specific tag type, please inform us, and we will prioritize its development.
Synonyms
yfjD; BSU08140; Uncharacterized lipoprotein YfjD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-185
Protein Length
Full Length of Mature Protein
Species
Bacillus subtilis (strain 168)
Target Names
yfjD
Target Protein Sequence
CLWLFYMGITFQTKYYLLAIPAGFLFTLFCLYLFIIFFPAFTPRGNTIFRIKTGKNGEVF TDKVSVTFTDIKKIEMSRHKFSLKGIFQEDILIQTVDQKTIRIPTWNIIPNPLFFEAVER YILPHLNEEAKSNWIGQFTDIQRSAYLKEFENHPKL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Lipid-anchor.

Q&A

What is the current state of knowledge about the YfjD protein in Bacillus subtilis?

YfjD is part of the yfj operon in Bacillus subtilis, which remains largely uncharacterized. Recent competition data suggest that the yfj operon (including yfjBC-YfjD) may encode a toxin-antitoxin system . The protein is classified as a lipoprotein, suggesting membrane association, though its precise cellular function and structural details remain to be fully elucidated. The gene is associated with the UniProt ID O31553 and Gene ID 939201, classified under the UPF0060 membrane protein family .

How can researchers optimize the yield of recombinant YfjD protein?

Optimizing yield requires a multi-faceted approach:

  • Strain selection: Use protease-deficient B. subtilis strains like WB800 or newer BRB collection strains lacking up to ten extracytoplasmic/secreted proteases to minimize product degradation .

  • Secretion enhancement: Consider co-expression of secretion machinery components, particularly overexpression of the intramembrane protease RasP, which has shown 2.5- to 10-fold improvements in secretion of difficult-to-produce enzymes under industrial fermentation-mimicking conditions .

  • Expression conditions: Optimize growth temperature, induction timing, and medium composition. For membrane-associated lipoproteins like YfjD, lower induction temperatures (16-25°C) often improve proper folding and prevent inclusion body formation.

  • Codon optimization: Adjust codons based on the expression host to enhance translation efficiency.

What are effective purification strategies for recombinant His-tagged YfjD?

Purification of His-tagged YfjD typically follows these methodological steps:

  • Cell lysis: For membrane-associated lipoproteins, use detergent-based lysis buffers (e.g., containing 1% Triton X-100 or n-dodecyl β-D-maltoside) to solubilize membrane fractions.

  • Immobilized Metal Affinity Chromatography (IMAC): The His-tag allows purification using Ni-NTA or similar resins. Initially use PBS buffer with added detergent .

  • Size Exclusion Chromatography (SEC): For higher purity, particularly when studying protein-protein interactions, follow IMAC with SEC to remove aggregates.

  • Quality assessment: Evaluate protein purity by SDS-PAGE (expected purity >80%) and confirm identity via Western blotting or mass spectrometry.

  • Endotoxin removal: For functional studies, ensure endotoxin levels are below 1.0 EU per μg of protein using the LAL method .

What analytical methods are recommended for characterizing the structural properties of YfjD?

For comprehensive structural characterization:

  • Circular Dichroism (CD) spectroscopy: Determine secondary structure elements and thermal stability.

  • Mass Spectrometry: Confirm molecular weight and identify post-translational modifications, particularly lipidation sites.

  • NMR spectroscopy: For detailed structural analysis of smaller domains or the complete protein if feasible.

  • X-ray crystallography: Attempt crystallization for high-resolution structure determination, though membrane-associated lipoproteins can be challenging to crystallize.

  • Cryo-electron microscopy: Consider for larger complexes or when YfjD is studied in the context of the complete toxin-antitoxin system.

  • Limited proteolysis combined with MS: Map domain boundaries and identify flexible regions.

How can researchers experimentally investigate the hypothesized toxin-antitoxin system function of the yfj operon?

To investigate the toxin-antitoxin (TA) system hypothesis, employ the following experimental approaches:

  • Growth inhibition assays: Express individual components (YfjB, YfjC, YfjD) separately and in combination to assess growth inhibition patterns typical of TA systems.

  • Co-immunoprecipitation studies: Use tagged versions of the proteins to identify direct interactions between components.

  • Conditional expression systems: Develop strains with inducible expression of individual components to observe phenotypic effects.

  • Structural biology approaches: Determine structures of individual components and complexes to identify motifs typical of known TA systems.

  • Transcriptional profiling: Monitor expression patterns under stress conditions, as TA systems are often differentially regulated during stress .

  • Deletion and complementation studies: Create knockouts of the operon components individually and in combination, followed by phenotypic characterization and complementation tests.

What is the potential role of YfjD in B. subtilis stress response and biofilm formation?

While direct evidence for YfjD's role is limited, research on similar uncharacterized proteins suggests several experimental approaches:

  • Transcriptomics: Analyze expression patterns of the yfj operon under various stress conditions (pH, oxidative, nutritional) to identify conditions that upregulate expression .

  • Biofilm assays: Compare biofilm formation between wild-type and yfjD knockout strains under standard and stress conditions. Recent data indicate that many uncharacterized proteins (12% in E. coli) participate in biofilm formation processes .

  • Fluorescent tagging: Create fluorescently tagged YfjD to visualize localization during biofilm development and stress response.

  • Proteomics: Identify interaction partners through pull-down assays coupled with mass spectrometry to place YfjD in cellular pathways.

  • Comparative genomics: Analyze conservation and genomic context across Bacillus species to infer functional associations.

How does YfjD compare to other uncharacterized bacterial lipoproteins with potential roles in stress adaptation?

Comparative analysis of YfjD with other uncharacterized bacterial lipoproteins reveals:

  • Sequence homology: YfjD shows structural domain similarities with other UPF0060 family membrane proteins, suggesting conserved functions.

  • Expression patterns: Like many uncharacterized proteins in bacterial systems, YfjD may be upregulated under specific stress conditions. In E. coli, approximately 18% of stress-responsive genes encode uncharacterized proteins .

  • Genomic context: The association with a potential toxin-antitoxin system distinguishes YfjD from many other uncharacterized lipoproteins, suggesting specialized functions in stress adaptation or population control.

  • Methodology for comparison:

    • Perform phylogenetic analysis of homologs across species

    • Compare stress-responsive expression patterns

    • Analyze shared structural motifs through computational modeling

    • Conduct complementation tests across species

What computational approaches can help predict the function of YfjD?

Several computational methods can generate testable hypotheses about YfjD function:

  • Homology modeling: Create structural models based on related proteins with known structures, particularly focusing on the UPF0060 membrane protein family characteristics.

  • Protein-protein interaction predictions: Use algorithms that predict potential binding partners based on sequence/structural features.

  • Genomic context analysis: Examine neighboring genes and conservation patterns across species, with particular attention to the toxin-antitoxin system hypothesis.

  • Molecular dynamics simulations: Model membrane interaction and dynamics to predict lipid binding sites and membrane topology.

  • Machine learning approaches: Utilize feature extraction from known lipoproteins to predict functional characteristics of YfjD.

  • Pathway enrichment analysis: Identify potential pathways based on co-expression patterns with characterized genes.

What challenges are commonly encountered when working with membrane-associated lipoproteins like YfjD?

Membrane-associated lipoproteins present several technical challenges:

  • Solubility issues: Lipoproteins often aggregate during purification due to exposed hydrophobic regions.

    • Solution: Screen multiple detergents or use amphipols for stabilization during purification.

  • Post-translational modification heterogeneity: Lipidation may be incomplete or variable.

    • Solution: Use mass spectrometry to characterize the lipidation state and consider in vitro lipidation for homogeneity.

  • Functional reconstitution: Activity may depend on membrane environment.

    • Solution: Test function in liposomes or nanodiscs that mimic native membrane composition.

  • Structural analysis difficulties: Membrane proteins are challenging for traditional structural biology techniques.

    • Solution: Consider newer techniques like cryo-EM or solid-state NMR for structural studies.

  • Expression toxicity: Overexpression may disrupt membrane integrity.

    • Solution: Use tightly controlled inducible expression systems and optimize induction conditions.

How can researchers differentiate between direct and indirect effects when studying the phenotypes of yfjD mutants?

Distinguishing direct from indirect effects requires rigorous experimental design:

  • Complementation studies: Reintroduce the wild-type gene to confirm phenotype reversibility.

  • Point mutations: Create functional domain mutations rather than complete deletions to identify critical residues.

  • Inducible expression systems: Use tightly controlled expression to observe immediate versus long-term effects of protein presence/absence.

  • Time-course experiments: Monitor changes immediately following induction or repression to identify primary effects.

  • Direct biochemical assays: Develop in vitro assays with purified components to confirm direct biochemical activities.

  • Multi-omics approaches: Combine transcriptomics, proteomics, and metabolomics to create comprehensive maps of cellular changes and identify primary pathways affected.

How might understanding YfjD function contribute to broader knowledge of bacterial stress adaptation systems?

Characterizing YfjD has several potential implications:

  • Novel stress response mechanisms: If confirmed as part of a toxin-antitoxin system, YfjD could represent a previously uncharacterized stress adaptation mechanism in Gram-positive bacteria.

  • Membrane-associated stress sensing: YfjD may function in sensing membrane perturbations during environmental stress, similar to how some uncharacterized proteins in E. coli respond to multiple stressors .

  • Biofilm regulation: Given the association between many uncharacterized proteins and biofilm formation, YfjD might represent a novel control point in Bacillus biofilm development.

  • Evolutionary conservation: Understanding YfjD function could reveal conserved stress adaptation mechanisms across bacterial species, particularly among Gram-positive bacteria with industrial and medical relevance.

  • Biotechnological applications: Knowledge of YfjD could inform strategies for strain improvement in protein production platforms, especially considering B. subtilis' importance in industrial protein secretion .

What experimental approaches would be most suitable for investigating potential interaction partners of YfjD?

To identify and characterize YfjD interaction partners:

  • Bacterial two-hybrid screening: Identify binary protein interactions using fusion constructs.

  • Proximity labeling: Use BioID or APEX2 fusions to identify proteins in close proximity to YfjD in vivo.

  • Co-immunoprecipitation with crosslinking: Preserve transient interactions through chemical crosslinking before pull-down.

  • Protein fragment complementation assays: Split reporter systems to visualize interactions in living cells.

  • Surface plasmon resonance: Quantify binding kinetics with purified components.

  • Native mass spectrometry: Identify stable complexes with preserved quaternary structure.

  • Blue native PAGE: Separate native membrane protein complexes for further analysis.

  • Synthetic genetic arrays: Identify genetic interactions that may indicate functional relationships.

What is the recommended protocol for analyzing the expression patterns of yfjD under different stress conditions?

Protocol for stress-responsive expression analysis:

  • Stress exposure conditions:

    • Acid stress: Adjust medium to pH 4.5 with HCl

    • Oxidative stress: Add 1 mM H₂O₂

    • Osmotic stress: Add 0.5 M NaCl

    • Nutrient limitation: Transfer to minimal medium

    • Biofilm conditions: Static growth in MSgg medium

  • Time points: Collect samples at 0, 15, 30, 60, 120, and 240 minutes post-stress exposure

  • RNA extraction and analysis:

    • Extract total RNA using hot phenol method

    • Perform RT-qPCR targeting yfjD and other yfj operon genes

    • Include known stress-responsive genes as positive controls

    • Normalize to multiple housekeeping genes (rpoB, gyrA)

  • Protein expression confirmation:

    • Create translational reporter fusions (YfjD-GFP)

    • Visualize cellular localization and expression levels

    • Perform Western blots with anti-YfjD antibodies

  • Data analysis: Compare fold changes across different stressors to identify specific or general stress responses

What methods can be used to investigate the membrane topology and localization of YfjD?

Protocol for membrane topology and localization determination:

  • Computational predictions:

    • Use topology prediction algorithms (TMHMM, Phobius)

    • Predict signal peptides and lipidation sites (SignalP, LipoP)

  • Biochemical fractionation:

    • Separate membrane and cytoplasmic fractions

    • Extract with different detergents to differentiate inner/outer membrane association

    • Perform proteinase K accessibility assays

  • Fluorescence microscopy:

    • Create C-terminal and N-terminal fluorescent protein fusions

    • Visualize localization patterns during growth and under stress

    • Use TIRF microscopy for detailed membrane localization

  • Cysteine accessibility methods:

    • Introduce cysteine residues at predicted topological positions

    • Determine accessibility using membrane-permeable and impermeable thiol-reactive reagents

  • Proteomic approaches:

    • Use surface shaving proteomics to identify exposed domains

    • Perform crosslinking mass spectrometry to map interaction surfaces

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.