Recombinant Bacillus subtilis Uncharacterized membrane protein ybfM (ybfM)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

YbfM is a 162-amino acid membrane protein encoded by the ybfM gene (locus tag BSU02280) in B. subtilis . Its recombinant form is produced by cloning the ybfM gene into expression vectors, followed by purification using affinity tags (e.g., His-tag) . Key properties include:

PropertySpecification
Molecular Weight~18–20 kDa (predicted)
Expression HostEscherichia coli (common host)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose
UniProt IDO31453

Genomic Neighborhood

  • ybfM is co-expressed in an operon with pssA (phosphatidylserine synthase) and psd (phosphatidylserine decarboxylase), which are essential for phosphatidylethanolamine (PE) biosynthesis .

  • The operon is regulated by the σ<sup>X</sup> transcription factor, linking YbfM to cell envelope stress responses .

Domain Architecture

  • Predicted transmembrane helices: 4–6 .

  • Conserved motifs: Glycine-rich regions and charged residues critical for lipid interaction .

Role in Lipid Transport

YbfM (renamed PetA in some studies) facilitates transbilayer movement of phosphatidylethanolamine (PE), a major phospholipid in B. subtilis . Key evidence includes:

  • Duramycin Sensitivity: Strains lacking ybfM exhibit resistance to duramycin, an antimicrobial peptide targeting surface-exposed PE .

  • Operon Synergy: Co-expression with PE biosynthetic genes (pssA, psd) suggests coordinated regulation of PE synthesis and transport .

Membrane Localization Dynamics

Fluorescent protein fusion studies indicate that YbfM localizes dynamically within membrane domains rather than uniformly distributing across the bilayer . This mobility may enable rapid adaptation to lipid asymmetry disruptions.

Recombinant Protein Use Cases

  • Antimicrobial Resistance Studies: Used to investigate PE-dependent resistance mechanisms against cationic peptides .

  • Lipid Transporter Characterization: Serves as a model for DedA superfamily proteins in Gram-positive bacteria .

  • Structural Biology: Purified recombinant YbfM is employed in crystallography and membrane protein folding assays .

Challenges and Limitations

  • Instability: Repeated freeze-thaw cycles degrade the protein, necessitating single-use aliquots .

  • Expression Yield: Low solubility in E. coli requires optimization (e.g., glycerol supplementation) .

  • Functional Redundancy: Genetic redundancy with other DedA paralogs (e.g., UptA) complicates phenotype analysis .

Future Directions

  • Mechanistic Studies: Resolving the atomic structure of YbfM to elucidate lipid-binding pockets .

  • Biotechnological Engineering: Leveraging B. subtilis secretion systems (Sec/Tat) for improved recombinant production .

  • Host-Pathogen Interactions: Exploring YbfM’s role in biofilm formation or gastrointestinal tract colonization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
ybfM; BSU02280; Uncharacterized membrane protein YbfM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ybfM
Target Protein Sequence
MELVQQLIADYGYLAIFLMLVLGIVGLPIPDEVMMTVVGYFTHTDVLNYELSILISFVGA LLGMLISYMIGRKAGRPFIDKYGKWVGLKEKRMMKVEKWMKKYGPYSLILGYFIPGVRHV TCYFSGIGKMDLKTYVAFAAIGAFLWCFVFITIGRVIGIIHV
Uniprot No.

Target Background

Database Links
Protein Families
DedA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the recommended expression systems for producing recombinant ybfM?

For recombinant expression of ybfM, several systems have been employed with varying degrees of success:

  • Heterologous expression in E. coli: Most commercial recombinant ybfM is produced in E. coli expression systems using fusion tags (commonly His-tags) for purification . This approach yields reasonable quantities of protein but may not preserve native folding due to differences in membrane composition between E. coli and B. subtilis.

  • Homologous expression in B. subtilis: For studies requiring native protein conformation, expression in B. subtilis strains with reduced protease activity (such as WB800, which lacks 8 extracellular proteases) is recommended . This approach typically utilizes IPTG-inducible promoters like spac or promoters derived from the groE operon .

  • Cell-free expression systems: For rapid production without cellular background, cell-free expression systems have been employed, particularly useful for initial characterization studies .

The choice of expression system should be guided by the specific research questions being addressed. For structural studies, homologous expression may preserve native folding, while heterologous expression may be more suitable for high-yield applications.

What purification strategies are most effective for isolating functional ybfM?

Purification of membrane proteins like ybfM presents unique challenges due to their hydrophobic nature. Based on current methodologies, the following strategies are recommended:

  • Detergent extraction: Gentle solubilization using non-ionic detergents (e.g., DDM, CHAPS) maintains protein structure while extracting from membranes.

  • Affinity chromatography: His-tagged ybfM can be purified using Ni-NTA chromatography, with careful optimization of imidazole concentrations to minimize non-specific binding .

  • Amphipol exchange: For functional studies, transferring purified ybfM from detergent to amphipols has shown promise in preserving native conformation .

  • Size exclusion chromatography: As a final polishing step, SEC provides assessment of protein homogeneity and oligomeric state .

For optimal results, purification should be conducted at 4°C with protease inhibitors to minimize degradation. Validation of proper folding can be assessed via circular dichroism spectroscopy focusing on characteristic α-helical signatures of transmembrane domains.

How can I design experiments to elucidate the function of ybfM in the phospholipid biosynthesis pathway?

To investigate ybfM's role in phospholipid biosynthesis, a multi-faceted experimental approach is recommended:

  • Gene deletion and complementation: Create a ΔybfM strain and assess changes in phospholipid composition using thin-layer chromatography and mass spectrometry. Complementation with wild-type and mutant variants can help identify critical functional residues .

  • Metabolic labeling: Use radioactive or stable isotope-labeled precursors to track phospholipid synthesis rates in wild-type versus ΔybfM strains.

  • Protein-protein interaction studies: Employ crosslinking, co-immunoprecipitation, or bacterial two-hybrid systems to identify interactions between ybfM and known phospholipid biosynthesis enzymes (PssA and Psd) .

  • Lipidomic analysis: Compare membrane lipid profiles of wild-type and ybfM mutant strains using LC-MS/MS to quantify changes in phosphatidylethanolamine and other phospholipids .

  • Stress response assays: Evaluate the sensitivity of ΔybfM strains to various stressors, particularly cationic antimicrobial peptides, which may reveal functional implications in membrane integrity .

Research by Salzberg et al. demonstrated that alterations in membrane lipid headgroup composition in B. subtilis led to modest effects on growth but significant changes in antimicrobial resistance, suggesting that phenotypic characterization should extend beyond standard growth assays .

What methods are suitable for studying ybfM's membrane topology and integration?

Understanding ybfM's topology is crucial for functional characterization. The following methods are recommended:

  • Cysteine scanning mutagenesis: Systematically introduce cysteine residues throughout ybfM and assess their accessibility to membrane-impermeable reagents, revealing which portions are exposed to different cellular compartments.

  • GFP fusion analysis: Create N- and C-terminal GFP fusions to determine cytoplasmic versus extracellular orientation of termini.

  • Protease protection assays: Treat membrane preparations with proteases in the presence and absence of detergents to identify protected transmembrane regions.

  • Computational prediction validation: Compare experimental findings with predictions from algorithms like TMHMM to refine topology models.

  • Cryo-EM or X-ray crystallography: For high-resolution structural information, though challenging with membrane proteins, these techniques can provide definitive topology data .

Lu et al. demonstrated successful structural determination of transmembrane proteins through a combination of computational design and experimental validation, suggesting similar approaches could be valuable for ybfM characterization .

How does ybfM expression relate to the extracytoplasmic stress response in B. subtilis?

The ybfM gene is part of the σX regulon, which responds to cell envelope stress in B. subtilis . Research suggests the following experimental approaches to investigate this relationship:

  • Transcriptional analysis: Measure ybfM expression using RT-qPCR or RNA-seq under various stress conditions (antimicrobial peptides, detergents, pH stress, etc.) in wild-type and σX mutant strains.

  • Promoter-reporter fusion assays: Create ybfM promoter fusions to reporter genes (e.g., lacZ, lux, gfp) to monitor expression dynamics in real-time during stress response.

  • ChIP-seq analysis: Determine direct binding of σX to the ybfM promoter region under different conditions.

  • Phenotypic characterization: Compare stress resistance profiles of ΔybfM and σX mutants to identify shared phenotypes that may indicate functional relatedness.

Studies by Salzberg et al. demonstrated that modifications to teichoic acids and incorporation of phosphatidylethanolamine into the cell membrane contribute to resistance against cationic antimicrobial peptides, suggesting ybfM may play a role in this defense mechanism through its involvement in PE biosynthesis .

What techniques can be used to investigate ybfM's interaction with other membrane components?

To elucidate ybfM's interactions within the membrane environment, consider these methodological approaches:

  • Chemical crosslinking coupled with mass spectrometry: Identify proximal proteins and lipids in the native membrane environment.

  • FRET analysis: Using fluorescently labeled ybfM and potential interaction partners to detect proximity in live cells.

  • Lipid binding assays: Assess specific interactions between purified ybfM and different lipid species using liposome flotation assays or surface plasmon resonance.

  • Native mass photometry: This emerging technique can reveal heterogeneous complex formation between membrane proteins and has been successfully applied to study protein-lipid-protein interactions that form structural lattices .

  • Microscale thermophoresis: Measure binding affinities between ybfM and other proteins or lipids in near-native conditions.

Research by Krishnan and Prasad showed that B. subtilis membrane proteins can form complexes important for cellular function, suggesting ybfM might participate in similar multiprotein assemblies .

How can computational approaches be integrated with experimental data to predict ybfM function?

Computational biology offers powerful tools for predicting protein function when combined with experimental data:

  • Homology modeling and molecular dynamics simulations: Generate structural models of ybfM and simulate its behavior in a membrane environment to predict functional domains and mechanisms.

  • Machine learning approaches: Apply methods like TabPFN (Tabular Probabilistic Few-shot Neural Network) to analyze patterns in experimental data that may reveal functional insights . TabPFN has demonstrated high accuracy with tabular data and could help identify relationships between ybfM expression and cellular phenotypes.

  • Network analysis: Integrate transcriptomic, proteomic, and metabolomic data to place ybfM in the context of cellular pathways, identifying potential functions based on guilt-by-association principles.

  • Evolutionary analysis: Compare ybfM sequences across bacterial species to identify conserved motifs that may indicate functional importance.

  • AlphaFold2 structure prediction: Generate high-confidence structural models as starting points for functional hypothesis generation.

For integration of computational models with experimental validation, an iterative approach similar to that described by Lu et al. for membrane protein design could provide valuable insights into ybfM function .

What biotechnological applications could exploit the properties of ybfM in engineered systems?

Though currently uncharacterized, membrane proteins like ybfM present opportunities for biotechnological applications:

  • Biosensor development: If ybfM responds to specific environmental conditions, it could be engineered as part of biosensor systems for detecting antimicrobial compounds or membrane stress.

  • Protein display platform: The B. subtilis expression system coupled with membrane proteins like ybfM could serve as a platform for surface display of heterologous proteins, leveraging the GRAS status of B. subtilis .

  • Vaccine delivery systems: Recombinant B. subtilis expressing ybfM fusions could potentially be developed as mucosal vaccine delivery systems, similar to approaches described for other B. subtilis membrane proteins .

  • Synthetic biology applications: Engineered versions of ybfM could potentially function as controllable membrane pores or transporters in synthetic biological systems.

Research by Oh et al. demonstrated that B. subtilis can be effectively used for expression of heterologous proteins, suggesting that ybfM-based systems could be developed for various applications once its function is better understood .

What strategies can address poor expression or misfolding of recombinant ybfM?

Membrane proteins like ybfM often present expression and folding challenges. Consider these methodological solutions:

  • Optimization of induction conditions: Test various inducer concentrations, induction temperatures (typically lowering to 16-25°C), and induction duration to minimize aggregation.

  • Fusion partners: N-terminal fusions with solubility-enhancing tags (MBP, SUMO) can improve expression and folding. A systematic comparison of fusion strategies showed up to 10-fold yield improvements for difficult membrane proteins .

  • Host strain engineering: Use specialized strains with altered membrane properties or additional chaperones. For B. subtilis expression, consider strains with reduced proteolytic activity like WB800 .

  • Membrane mimetics: During purification, screen different detergents, nanodiscs, or amphipols to identify optimal conditions for maintaining native folding .

  • Codon optimization: Adapt the coding sequence to the preferred codon usage of the expression host.

A systematic troubleshooting approach should assess protein expression at multiple stages using techniques like western blotting, fluorescence-based fusion reporters, and activity assays to determine the specific bottleneck in production.

How can I validate that my purified ybfM retains its native conformation and functionality?

Confirming proper folding and function of purified membrane proteins remains challenging. These approaches provide complementary validation:

  • Circular dichroism spectroscopy: Assess secondary structure content, particularly α-helical signatures characteristic of transmembrane domains.

  • Thermal stability assays: Techniques like differential scanning fluorimetry with appropriate dyes can assess protein stability and identify stabilizing conditions.

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): Confirm homogeneity and proper oligomeric state.

  • Reconstitution into liposomes: Functional membrane proteins should successfully incorporate into artificial membranes.

  • Functional complementation: Express purified ybfM in ΔybfM strains to assess restoration of phenotype.

  • Mass photometry: This emerging technique can assess homogeneity and complex formation in membrane protein samples without the need for labeling .

Research by Meyer et al. demonstrated that functional validation should incorporate multiple techniques, as single assays may not comprehensively assess membrane protein integrity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.