Recombinant Bacillus subtilis Uncharacterized membrane protein ybgB (ybgB)

Shipped with Ice Packs
In Stock

Description

Regulatory Context and Genomic Organization

ybgB is transcriptionally regulated by the extracytoplasmic function (ECF) sigma factor σY (sigY) . Key regulatory features include:

Regulatory ElementFunction
σY Autoregulatory PromoterBinds upstream of sigY, driving operon expression
Negative RegulatorsYxlD and YxlE (encoded in yxlCDEFG) repress σY activity
Operon StructuresigY-yxlCDEFG operon; ybgB is transcribed independently

The ybgA-gamAP synton, unique to B. subtilis, includes ybgB but lacks clear functional overlap with amino sugar metabolism genes (gamAP) . Microarray studies show ybgB expression increases 71-fold in σY-activated strains, indicating direct σY-dependent regulation .

Membrane Localization and Potential Roles

  • Transport/Regulation: ybgB’s hydrophobicity and operon context suggest involvement in membrane-associated transport or stress response pathways .

  • Secondary Metabolism: While not directly linked to known B. subtilis secondary metabolites (e.g., pigments ), its regulation by σY—a stress-responsive sigma factor—hints at adaptive roles .

Experimental Insights

Study TypeObservationSource
Transcriptional ProfilingybgB upregulated in yxlC::Tn10 mutants (σY activation)
ROMA AnalysisybgB identified as a direct σY target gene
Genomic ContextCo-located with gamAP (glucosamine metabolism) but no functional overlap

Recombinant Protein Production

The recombinant ybgB protein is commercially available for research, enabling:

  • Structural Studies: NMR or X-ray crystallography to resolve membrane topology.

  • ELISA: Detection of ybgB-specific antibodies or interactions .

  • Functional Screens: Testing transport activity or regulatory interactions with σY/YxlD/YxlE .

Future Research Directions

  1. Functional Characterization:

    • Heterologous expression in E. coli to test transport activity.

    • Knockout studies in B. subtilis to assess phenotypic effects.

  2. Structural Elucidation:

    • Cryo-EM or NMR to determine membrane topology and interactions.

  3. Regulatory Interactions:

    • Co-IP or ChIP-seq to confirm σY binding to the ybgB promoter .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ybgB; BSU02380; Uncharacterized membrane protein YbgB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-91
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ybgB
Target Protein Sequence
MFLFTNGKVLWGAVIAAFILSIVFYPFLPTQMPIHYDVANSPDLTVNKLAGTVMLPVLMV VFAWARKINWQFVFAVYILLICHIVVLCLAL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.