Recombinant Bacillus subtilis Uncharacterized membrane protein yczE (yczE)

Shipped with Ice Packs
In Stock

Description

Functional Context in Bacillus subtilis

While yczE remains uncharacterized, homologs in B. subtilis (e.g., SpoIIIJ and YqjG) are implicated in membrane protein biogenesis:

  • Role in Membrane Insertion: SpoIIIJ and YqjG facilitate Sec-dependent and -independent insertion of cytochrome oxidase and ATP synthase subunits, suggesting yczE may participate in similar processes .

  • Association with ATP Synthase: SpoIIIJ/YqjG copurify with the F1Fo ATP synthase complex, hinting at a potential late-stage assembly role for related proteins .

3.1. Expression Platforms

B. subtilis is a preferred host for recombinant protein production due to:

  • GRAS/QPS Status: Safe for industrial and biomedical applications .

  • Secretion Efficiency: Engineered strains (e.g., WB800N) optimize yields .

Table 1: Key B. subtilis Expression Features

FeatureAdvantageExample Strain/System
Endotoxin-FreeSimplified purificationWB800N
Protease-Deficient StrainsReduced protein degradationBINGO platform
Signal Peptide LibrariesEnhanced secretionIngenza’s 94-peptide library

3.2. yczE-Specific Production

  • Cloning Vectors: pHT43 and pUC57 plasmids are commonly used for heterologous expression in B. subtilis .

  • Storage: Recombinant yczE is stable at -20°C to -80°C, with glycerol (50%) recommended for long-term storage .

Research Gaps and Future Directions

  • Functional Annotation: No direct studies on yczE’s biological role exist; homology modeling or knockout studies could elucidate its function.

  • Optimization: Screening yczE with diverse promoters (e.g., P43, Pgrac) or signal peptides may improve expression .

Implications for Biotechnology

  • Membrane Protein Studies: yczE serves as a model for exploring gram-positive bacterial membrane dynamics.

  • Industrial Relevance: B. subtilis’s scalability and safety profile make it ideal for producing uncharacterized proteins like yczE at scale .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will then prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its inclusion in the production process.
Synonyms
yczE; BSU03580; Uncharacterized membrane protein YczE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yczE
Target Protein Sequence
MKQELVLRWTFYFAGLIILAFGVSLTIEGKALGISPWDAFHYSLFQHFGLTVGQWSIIIG ALIVGFTSLFTRAWPKIGALLNMVLIGVFIDFFNFILPALSTYTGSIIVFSLGVVLIGYG VGVYVSAGLGAGPRDSLMMLITEKTGWNVQWVRNGMELTILFAAWGMGGPIGFGTILTAI LTGLILRFSLPQSIQLLNYAVARRTAAVKASPPVH
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.