Recombinant Bacillus subtilis Uncharacterized membrane protein ydaK (ydaK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ydaK; BSU04280; Uncharacterized membrane protein YdaK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ydaK
Target Protein Sequence
MKISFSESQKLFAYFSGLIAALSLFIYYVSAQQSEGALILCITFGVIAAGIWFGPIYALA VTLIVLFVLGTLMMFFQTGQTSLFPAEEGLRMLVVWGIALLLFSFISGRIHDITAELRRS MTRLQSEIKSYVAVDRVTGFDNKQRMKLELSEEIKRAERYGNSFVFLLLHMHYFKEFKSL YGEKETDRLFQYVGQQIRTSVRETDKKFRPSDERIGIVLTHTPAEHMPAVLTKLKKQLDT YQLENGKYVSLTFHVCYLPYRNDIQTADQFLEELENEMMMNEL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the ydaK membrane protein in Bacillus subtilis and why is it significant for research?

The ydaK protein is an uncharacterized membrane protein in Bacillus subtilis with potential significance in cellular processes. As a membrane protein, it likely plays a role in cellular communication, transport, or signal transduction, similar to other membrane proteins that act as channels or receptors for cell-environment interactions . The uncharacterized nature of this protein makes it an important target for basic research, as elucidating its structure and function may reveal new insights into bacterial membrane biology and potentially identify novel targets for antimicrobial development.

The significance of studying ydaK lies in expanding our understanding of the B. subtilis membrane proteome. Like other membrane proteins, ydaK likely contains multiple transmembrane domains that anchor it within the bacterial membrane, possibly arranged in a specific conformation that facilitates its function. Understanding this arrangement is crucial for determining structure-function relationships .

What are the most suitable expression vectors for recombinant ydaK protein in B. subtilis?

For recombinant expression of ydaK in B. subtilis, plasmid pHT254 is highly recommended based on successful protocols for membrane protein expression . This expression system utilizes either the Pgrac or Pgrac100 promoter, which provides controlled and efficient protein expression. The pHT254 vector has been optimized for B. subtilis and contains appropriate selection markers and regulatory elements for effective transformation and protein production .

The choice between Pgrac and Pgrac100 promoters depends on the desired expression level. Pgrac100 generally provides stronger expression, which may be beneficial for proteins that express poorly, but could potentially lead to inclusion body formation with membrane proteins. For initial experiments with ydaK, it may be prudent to test both promoters to determine which provides the optimal balance between expression level and protein solubility.

How does the expression strategy for ydaK differ from cytoplasmic proteins in B. subtilis?

Expressing membrane proteins like ydaK differs fundamentally from cytoplasmic proteins due to their hydrophobic nature and need for proper insertion into the membrane. Unlike cytoplasmic proteins, membrane proteins require specialized membrane insertion machinery such as YidC insertase or the SecY complex . The expression strategy must therefore account for:

  • Slower expression rates to prevent overwhelming the membrane insertion machinery

  • Co-translational insertion mechanisms that couple protein synthesis to membrane integration

  • Potential toxicity issues if overexpression leads to membrane disruption

  • Need for proper folding and assembly within the lipid bilayer environment

For ydaK specifically, expression conditions should be optimized to ensure proper targeting to the membrane insertion pathway. This may involve using lower induction concentrations and temperatures compared to cytoplasmic proteins, as well as carefully optimizing media composition to support membrane biogenesis .

What experimental design approach is most effective for optimizing ydaK expression in B. subtilis?

A multivariant statistical experimental design approach is most effective for optimizing ydaK expression. This method allows researchers to evaluate multiple variables simultaneously and determine statistically significant factors affecting protein expression . For membrane proteins like ydaK, several critical variables should be considered:

VariableRange to TestPotential Impact
Induction temperature18-37°CLower temperatures often improve membrane protein folding
Inducer concentration0.1-1.0 mM IPTGAffects expression rate and potential aggregation
Media compositionDefined vs. complexInfluences cell growth and membrane composition
Post-induction time4-16 hoursAffects final yield and protein quality
Cell density at inductionOD600: 0.6-1.2Critical for balancing growth and expression
Carbon sourceGlucose vs. glycerolAffects metabolism and membrane fluidity
Salt concentration0.1-0.5 M NaClInfluences membrane stability and protein folding

Using a fractional factorial design (e.g., 2^(8-4)) with central point replicates would allow efficient screening of these variables with minimal experiments . The responses to measure should include cell growth, protein yield, and functional activity of ydaK, if an assay is available.

What is the recommended protocol for transforming B. subtilis with recombinant ydaK constructs?

The recommended transformation protocol for B. subtilis with recombinant ydaK constructs involves several key steps:

  • Prepare competent B. subtilis cells:

    • Grow cells in competence medium to early stationary phase

    • Add glycerol to 10% final concentration

    • Store aliquots at -80°C

  • Transformation procedure:

    • Thaw competent cells on ice

    • Add 1-5 μg of plasmid DNA containing the ydaK gene

    • Incubate at 37°C for 30-60 minutes with gentle shaking

    • Plate on selective media containing appropriate antibiotics

    • Incubate at 37°C for 16-24 hours

  • Confirmation of transformation:

    • Screen colonies by colony PCR targeting the ydaK gene

    • Verify plasmid integrity by restriction analysis

    • Confirm expression by small-scale induction tests followed by Western blotting

For membrane proteins like ydaK, it's important to ensure that the strain used for transformation has all necessary machinery for proper membrane insertion. B. subtilis 168 is often recommended as it has well-characterized membrane protein insertion pathways .

How can we determine the optimal induction conditions for soluble ydaK expression?

Determining optimal induction conditions for soluble ydaK expression requires a systematic approach focusing on parameters that affect membrane protein folding and insertion:

  • Temperature optimization:

    • Lower temperatures (16-25°C) often promote proper folding of membrane proteins

    • Test a range of temperatures during induction phase

    • Monitor both yield and solubility at each temperature

  • Inducer concentration:

    • For IPTG-inducible systems, test concentrations from 0.05-0.5 mM

    • Lower concentrations often result in slower expression but better folding

    • Consider auto-induction systems for gentler expression

  • Media supplementation:

    • Add glycerol (0.5-2%) to stabilize membranes

    • Test different nitrogen sources (peptone, tryptone variations)

    • Consider adding specific lipids that might facilitate membrane protein folding

  • Time-course analysis:

    • Sample at multiple time points (2, 4, 6, 8 hours post-induction)

    • Analyze both total and soluble fractions

    • Determine point of maximum yield before aggregation occurs

A 4-hour induction period has been shown to be optimal for many recombinant proteins, balancing productivity against potential degradation or aggregation . For ydaK specifically, monitor the protein localization by fractionating cells to confirm proper membrane integration rather than cytoplasmic aggregation.

What methods are most effective for confirming the proper membrane insertion of ydaK?

Confirming proper membrane insertion of ydaK requires multiple complementary approaches:

  • Subcellular fractionation:

    • Separate cytoplasmic, membrane, and periplasmic fractions

    • Use ultracentrifugation with sucrose gradients for membrane isolation

    • Analyze fractions by Western blotting with anti-ydaK antibodies

    • True membrane insertion shows ydaK predominantly in membrane fractions

  • Protease accessibility assays:

    • Treat intact cells or spheroplasts with proteases (e.g., trypsin)

    • Domains exposed outside the membrane will be digested

    • Compare digestion patterns to predicted topology

    • This method helps confirm the orientation of ydaK in the membrane

  • GFP-fusion analysis:

    • Create C-terminal and N-terminal GFP fusions

    • Fluorescence microscopy can visualize membrane localization

    • Comparison with known membrane protein controls

    • Fluorescence patterns should show membrane distribution rather than cytoplasmic aggregation

  • Lipid-protein interaction analysis:

    • Use MD simulations to predict lipid interactions

    • Verify experimentally with crosslinking or fluorescence assays

    • Proper insertion shows specific lipid-protein contacts

The combination of these methods provides strong evidence for correct membrane insertion and can also help determine the topology and orientation of ydaK within the membrane.

How can we assess the topology and structural features of ydaK protein in the membrane?

Assessing ydaK topology and structural features requires a combination of computational prediction and experimental validation:

  • Computational topology prediction:

    • Use multiple transmembrane prediction tools (TMHMM, HMMTOP, Phobius)

    • Generate consensus models of transmembrane domains

    • Predict cytoplasmic and periplasmic loops

    • Identify potential functional motifs within the sequence

  • Cysteine accessibility method:

    • Introduce single cysteine residues at different positions

    • Treat with membrane-permeable and impermeable thiol reagents

    • Selective labeling pattern reveals topology

    • Results can confirm which regions are cytoplasmic, periplasmic, or transmembrane

  • Epitope insertion scanning:

    • Insert small epitope tags (FLAG, HA) at predicted loop regions

    • Determine accessibility by immunofluorescence microscopy

    • Accessible tags in intact cells are extracellular

    • Requires permeabilization to detect intracellular tags

  • Evolutionary co-variation analysis:

    • Similar to methods used for YidC structure determination

    • Identifies residues that co-evolve, suggesting proximity

    • Provides constraints for structural modeling

    • Can reveal important interaction interfaces

  • Molecular dynamics simulations:

    • Model ydaK in lipid bilayer environment

    • Analyze stability of different topological models

    • Identify lipid-interacting residues

    • Predict functionally important structural features

Integration of these approaches provides a comprehensive model of ydaK structure that can guide functional studies and potential interaction analysis.

What are the challenges in purifying recombinant ydaK and how can they be addressed?

Purifying membrane proteins like ydaK presents several challenges that require specialized approaches:

ChallengeCauseSolution Strategy
Poor solubilizationHydrophobic transmembrane domainsTest different detergents (DDM, LDAO, FC-12) systematically
Low yieldLimited expression and/or extraction efficiencyOptimize expression conditions; scale up culture volume
Protein instabilityDetergent-induced denaturationAdd stabilizers (glycerol, specific lipids); use nanodisc technology
Aggregation during purificationImproper refolding or detergent exchangeCareful optimization of buffer conditions; avoid concentration steps
Loss of functionDisruption of native lipid interactionsReconstitution into proteoliposomes or nanodiscs after purification

A recommended purification workflow for ydaK includes:

  • Initial membrane isolation by ultracentrifugation

  • Detergent screening at small scale (96-well format)

  • Solubilization optimization (detergent:protein ratio, time, temperature)

  • Affinity purification using a strategically placed tag (His6 or Strep)

  • Size exclusion chromatography to remove aggregates

  • Optional reconstitution into nanodiscs for functional studies

For ydaK specifically, consider adding a C-terminal tag rather than N-terminal to avoid interfering with potential N-terminal signal sequences involved in membrane targeting. Additionally, perform functional assays at each purification step to ensure the protein retains its native conformation.

What approaches can be used to identify potential functions of the uncharacterized ydaK protein?

Identifying functions of uncharacterized membrane proteins like ydaK requires a multifaceted approach:

  • Bioinformatic analysis:

    • Sequence homology searches against characterized proteins

    • Identification of conserved domains or motifs

    • Genomic context analysis (adjacent genes often have related functions)

    • Co-evolution networks to identify functional partners

  • Phenotypic characterization:

    • Creation of ydaK deletion mutants

    • Comprehensive phenotypic screening (growth conditions, stress responses)

    • Complementation studies with wild-type and mutant variants

    • Transcriptome/proteome comparison between wild-type and mutant strains

  • Protein-protein interaction studies:

    • Pull-down assays using tagged ydaK

    • Bacterial two-hybrid screening

    • Chemical crosslinking followed by mass spectrometry

    • Co-immunoprecipitation with candidate interacting proteins

  • Localization studies:

    • Fluorescent protein fusions to determine subcellular localization

    • Co-localization with known membrane protein complexes

    • Time-lapse microscopy to monitor dynamic localization changes

    • Super-resolution microscopy for detailed membrane distribution analysis

Each positive result from these approaches provides clues about ydaK function that can guide more targeted functional assays.

How can we establish a reliable functional assay for ydaK activity?

Establishing a functional assay for an uncharacterized protein like ydaK requires informed hypothesis generation based on preliminary data:

  • Transport function assessment:

    • If sequence analysis suggests transporter activity, screen substrate uptake

    • Prepare proteoliposomes with purified ydaK

    • Test uptake of radiolabeled or fluorescent potential substrates

    • Compare uptake rates with control liposomes

  • Signaling activity:

    • Monitor changes in second messenger levels (cAMP, c-di-GMP)

    • Assess protein phosphorylation states in response to stimuli

    • Measure changes in gene expression of potential downstream targets

    • Use reporter fusions to monitor activation of signaling pathways

  • Protein-lipid interactions:

    • Assess binding to specific lipids using lipid overlay assays

    • Monitor changes in membrane fluidity or organization

    • Test effects of lipid composition changes on ydaK activity

    • Evaluate potential lipid flippase or scramblase activity

  • Structural changes:

    • Monitor conformational changes upon substrate binding

    • Use site-directed fluorescence labeling to detect movements

    • Employ techniques like FRET to measure distance changes

    • Correlate structural changes with functional outcomes

Development of a reliable assay will likely require iterative refinement as more information about ydaK becomes available. Initial screening should be broad, with more focused assays developed as hypotheses about function emerge.

What site-directed mutagenesis approach would be most effective for structure-function analysis of ydaK?

An effective site-directed mutagenesis strategy for ydaK structure-function analysis should target key residues systematically:

  • Prioritize residue selection based on:

    • Evolutionary conservation across homologs

    • Predicted functional domains or motifs

    • Charged or polar residues within transmembrane regions (often functionally critical)

    • Residues identified through evolutionary co-variation analysis

    • Potential interaction interfaces from structural models

  • Design a strategic mutation panel:

    • Conservative substitutions (e.g., Asp→Glu) to test chemistry

    • Non-conservative substitutions (e.g., Asp→Ala) to test essentiality

    • Cysteine substitutions for subsequent modification studies

    • Introduce residues sensitive to chemical modification

  • Experimental validation should include:

    • Expression level and membrane integration confirmation

    • Functional assays (once established)

    • Thermal stability measurements to assess structural integrity

    • In vivo complementation tests in ydaK deletion strains

A particularly effective approach based on studies of other membrane proteins would be to create an alanine scanning library across predicted functional domains . From the YidC study, we learned that mutation of key stabilizing residues (equivalent to T362 and Y517 in YidC) completely inactivated the protein despite proper expression and membrane integration . Similar critical residues likely exist in ydaK and could provide important insights into its function.

How can we determine if ydaK forms oligomeric structures in the membrane?

Determining ydaK oligomerization status requires several complementary approaches:

  • Biochemical methods:

    • Blue native PAGE of solubilized membranes

    • Crosslinking studies with variable-length crosslinkers

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation of detergent-solubilized protein

  • Biophysical approaches:

    • Förster resonance energy transfer (FRET) between differentially labeled ydaK molecules

    • Single-molecule tracking to observe diffusion characteristics

    • Fluorescence recovery after photobleaching (FRAP) to assess mobility

    • Disulfide crosslinking of engineered cysteine pairs at predicted interfaces

  • Computational analysis:

    • Molecular docking of ydaK monomers

    • Prediction of oligomerization interfaces based on evolutionary co-variation

    • Molecular dynamics simulations of potential oligomeric assemblies

    • Comparison with known oligomeric membrane protein structures

  • In vivo studies:

    • Genetic complementation with mix-and-match mutant subunits

    • Split-protein complementation assays

    • Co-immunoprecipitation of differentially tagged variants

    • Dominant-negative effects of mutant subunits

The combination of these methods can provide strong evidence for specific oligomeric states and the interfaces involved in oligomerization.

What are the most common issues in recombinant ydaK expression and how can they be resolved?

Common issues in recombinant membrane protein expression, including ydaK, and their solutions include:

IssueSymptomsResolution Strategies
Protein toxicityPoor growth after induction, plasmid instabilityUse tighter promoter control, lower inducer concentration, test different host strains
Inclusion body formationProtein in insoluble fraction, visible aggregatesLower expression temperature, use solubility-enhancing tags, optimize media composition
Improper membrane insertionFound in cytoplasmic fraction, degradation productsOptimize signal sequence, slow down translation rate, ensure membrane insertion machinery is not overwhelmed
Low expression levelsWeak band on Western blotOptimize codon usage, modify 5' mRNA structure, test different promoters and ribosome binding sites
Protein degradationMultiple bands, decreasing yield over timeAdd protease inhibitors, use protease-deficient strains, modify cultivation conditions

For troubleshooting ydaK expression specifically:

  • Start with small-scale expression screening to rapidly test multiple conditions

  • Use experimental design approach to systematically evaluate variables

  • Consider fusion partners that enhance membrane protein expression (e.g., Mistic, GFP)

  • Examine the effects of different media components on membrane protein yield

  • Test alternative B. subtilis strains with different protease profiles or membrane compositions

The multivariant analysis approach is particularly valuable for resolving complex expression issues, as it can identify non-obvious interactions between variables that affect protein expression .

How can advanced structural techniques be applied to study ydaK structure and interactions?

Advanced structural techniques can provide crucial insights into ydaK's structure and interactions:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for purified ydaK

    • Can resolve structures to near-atomic resolution

    • Particularly valuable for membrane proteins resistant to crystallization

    • Useful for capturing different conformational states

    • Similar to the approach used for YidC-ribosome complex

  • Solid-state NMR spectroscopy:

    • Can study membrane proteins in lipid environments

    • Provides information on dynamic regions and conformational changes

    • Requires isotopic labeling (13C, 15N) of recombinant ydaK

    • Can determine local structure and lipid interactions

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps solvent accessibility and structural dynamics

    • Identifies ligand binding sites and conformational changes

    • Relatively low sample requirements

    • Useful for membrane proteins in detergent micelles

  • Cross-linking mass spectrometry (XL-MS):

    • Identifies residues in close proximity

    • Can map interaction interfaces with partner proteins

    • Provides distance constraints for structural modeling

    • Compatible with membrane environments

  • Molecular dynamics simulations:

    • Model ydaK behavior in membrane environments

    • Predict lipid interactions and functional dynamics

    • Test hypotheses about conformational changes

    • Can incorporate experimental constraints from other methods

Integration of data from multiple techniques, as demonstrated in the YidC study , provides the most comprehensive structural understanding. For ydaK, a promising approach would be to express sufficient quantities for cryo-EM analysis, supplemented with crosslinking and biochemical studies to validate the structural model.

How should we analyze contradictory data regarding ydaK function or localization?

When facing contradictory data regarding ydaK, a systematic approach to resolution is necessary:

  • Experimental conditions comparison:

    • Systematically document all variables between contradictory experiments

    • Consider differences in expression systems, tags, buffer conditions

    • Evaluate potential artifacts introduced by experimental methods

    • Test reproducibility with standardized protocols

  • Methodological validation:

    • Apply multiple independent techniques to test the same hypothesis

    • Validate reagents (antibodies, constructs) with appropriate controls

    • Consider limitations of each method and potential technical artifacts

    • Implement blind analysis where appropriate to reduce bias

  • Reconciliation strategies:

    • Consider if contradictions represent different functional states of ydaK

    • Test if post-translational modifications explain different observations

    • Evaluate if protein interactions change under different conditions

    • Determine if oligomerization state affects function or localization

  • Hypothesis refinement:

    • Develop new hypotheses that account for seemingly contradictory results

    • Design critical experiments that can distinguish between competing models

    • Use computational modeling to explore mechanistic explanations

    • Consider context-dependent functions that may explain disparate results

Document all contradictions thoroughly, as they often lead to deeper insights about protein function and regulation when properly resolved.

What bioinformatic resources are most useful for analyzing uncharacterized membrane proteins like ydaK?

Several bioinformatic resources are particularly valuable for uncharacterized membrane proteins:

Resource TypeSpecific ToolsApplication for ydaK Analysis
Transmembrane topology predictionTMHMM, TOPCONS, PhobiusPredict membrane-spanning regions and orientation
Evolutionary analysisConSurf, EVfold, GREMLINIdentify conserved regions and co-evolving residues
Structural predictionAlphaFold, RoseTTAFold, I-TASSERGenerate structural models, particularly valuable for membrane proteins
Functional annotationInterPro, Pfam, CATHIdentify conserved domains and potential functions
Genomic contextSTRING, GeConT, MicrobesOnlineAnalyze gene neighborhood and potential functional associations
Molecular dynamics resourcesCHARMM-GUI, NAMD, GROMACSSet up membrane protein simulations to study dynamics

For ydaK specifically, a workflow might include:

  • Initial sequence analysis with transmembrane prediction tools

  • Identification of homologs using sensitive sequence search methods (HHpred, HMMER)

  • Multiple sequence alignment of homologs to identify conserved regions

  • Evolutionary co-variation analysis to predict residue contacts

  • Structural modeling using AlphaFold or similar tools

  • Validation of the model through molecular dynamics simulations

  • Functional annotation based on structural similarities to characterized proteins

This integrated bioinformatic approach can provide valuable hypotheses about ydaK function that guide experimental design.

How can we integrate multiple datasets to build a comprehensive model of ydaK function?

Integrating diverse datasets for a comprehensive understanding of ydaK requires a systematic approach:

  • Data harmonization:

    • Standardize nomenclature across datasets

    • Normalize experimental conditions where possible

    • Establish common reference points between experiments

    • Create unified data structures for computational integration

  • Multi-omics integration:

    • Correlate transcriptomics data with proteomics

    • Map metabolomic changes to ydaK expression levels

    • Connect phenotypic data with molecular measurements

    • Integrate structural information with functional measurements

  • Network analysis:

    • Build protein-protein interaction networks

    • Identify genetic interactions through synthetic lethality or suppression

    • Map metabolic pathways potentially involving ydaK

    • Analyze co-expression networks to identify functionally related genes

  • Bayesian integration:

    • Develop probabilistic models incorporating multiple evidence types

    • Weight evidence based on reliability and relevance

    • Update functional hypotheses as new data becomes available

    • Identify gaps requiring additional experiments

  • Visualization strategies:

    • Create interactive visualizations of integrated data

    • Use dimension reduction techniques to reveal patterns

    • Develop structural models incorporating functional data

    • Generate testable hypotheses from integrated analysis

This approach has proven effective for characterizing previously unknown membrane proteins, allowing researchers to converge on function through multiple lines of evidence rather than relying on a single experimental approach.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.