Recombinant Bacillus subtilis Uncharacterized membrane protein ydfK (ydfK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, kindly indicate your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference for your own preparations.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us and we will prioritize its development if feasible.
Synonyms
ydfK; BSU05450; Uncharacterized membrane protein YdfK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ydfK
Target Protein Sequence
MFGTIFNTVMIIAGSIIGGIFKKGIKDEYQDILMQAMGFAAVALGINAITQHLPDSKYPI LFIVSLAIGGLLGQIINLELRFNKLVNKFSKSNLAEGLSTAVLLFCIGSLSILGPVEAAL HGDYTYLLTNGMLDGITSIVLASTFGFGIAAAALVLFSWQGSIYLFAQVMESAINTDLIN EITIVGGILILSSGLSILGIKKFKTLNLLPSLLIPPVVIFVIHAFGLRF
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What experimental approaches are recommended for initial characterization of the uncharacterized membrane protein ydfK?

For initial characterization of an uncharacterized membrane protein like ydfK, researchers should employ a systematic approach starting with bioinformatic analysis to identify conserved domains, predicted topology, and potential functions. This should be followed by expression studies using a vector system compatible with Bacillus subtilis. Based on established protocols for membrane proteins, solubilization in detergents such as DDM (n-dodecyl-β-D-maltoside) at 0.02% concentration is often effective, similar to approaches used for other membrane proteins . Purification via affinity chromatography using a His-tag system followed by size exclusion chromatography provides a solid foundation for further structural and functional studies.

How does the recO gene research methodology in B. subtilis inform approaches to studying ydfK?

The methodological approach used in recO gene characterization provides a valuable template for investigating ydfK. In the recO studies, researchers identified homology with E. coli proteins (25% identity), created null alleles to study phenotypic effects, and systematically introduced mutations into recombination-deficient strains to understand gene function and interactions . For ydfK research, similar approaches would involve creating knockout mutants to observe phenotypic changes, conducting complementation studies, and examining protein-protein interactions to place ydfK in its proper cellular context and pathway. The epistatic analysis approach used with recO can be particularly valuable for determining the relationship between ydfK and other membrane proteins in B. subtilis.

What are the optimal growth and induction conditions for expressing recombinant ydfK in B. subtilis?

Based on established protocols for membrane protein expression in bacterial systems, optimal growth conditions for expressing recombinant ydfK in B. subtilis typically involve using BL21(DE3) expression strains grown in LB medium supplemented with appropriate antibiotics. Induction should be performed at an OD of 0.4-0.7 followed by expression for approximately 3 hours at 37°C . Some membrane proteins benefit from lower induction temperatures (16-30°C) to enhance proper folding and prevent aggregation. Cell harvesting should be done by low-speed centrifugation (10,000 x g, 6 min), followed by resuspension in appropriate buffer systems such as 50 mM Tris-HCl (pH 8), 100 mM NaCl, and 10% glycerol . Optimizing these conditions often requires systematic testing of temperature, induction timing, and buffer compositions.

How should experiments be designed to avoid bias when characterizing the function of ydfK?

Experimental design for characterizing ydfK should adhere to rigorous principles to avoid bias. As noted in experimental design guidelines, "experiments need to be carried out without bias no matter how elegant a hypothesis may be"3. For ydfK characterization, this means clearly defining independent and dependent variables before experimentation begins. The independent variable would be the experimental condition you're manipulating (e.g., expression levels of ydfK, presence/absence of the protein, or environmental conditions), while the dependent variable would be the measured outcome (e.g., growth rate, membrane integrity, or protein interaction patterns)3. Controls must include wild-type strains, empty vector controls, and ideally multiple B. subtilis genetic backgrounds to avoid strain-specific effects. Blind analysis of data where possible and replication across independent experiments are essential to minimize confirmation bias.

What membrane protein stabilization techniques are most appropriate for structural studies of ydfK?

For structural studies of ydfK, the Peptidisc method offers significant advantages over traditional approaches. Unlike nanodiscs, which require scaffold proteins of different lengths and precise amounts of matching lipids, the Peptidisc method uses a short amphipathic bi-helical peptide (NSPr) and requires no additional lipids . This "one size fits all" approach is particularly valuable for uncharacterized membrane proteins like ydfK where optimal lipid environments are unknown. The Peptidisc method can be integrated into purification protocols as "on-column," "in-gel," or "on-bead" reconstitution . For ydfK structural studies, on-column reconstitution would likely be most efficient, performed by loading the NSPr peptide onto a column containing detergent-solubilized ydfK, followed by detergent removal. This method has proven effective for diverse membrane protein assemblies and would provide a stable environment for ydfK during structural analysis via cryo-EM or crystallography.

What are the critical considerations for designing a ydfK knockout experiment in B. subtilis?

Designing a ydfK knockout experiment requires careful consideration of several factors. Based on approaches used for recO gene analysis, a complete null allele should be created rather than a point mutation to ensure complete loss of function . The knockout construct should be designed to avoid polar effects on neighboring genes, particularly if ydfK is part of an operon. As demonstrated in recO research, the knockout should be introduced into multiple genetic backgrounds, including both wild-type and strains with deficiencies in related pathways to assess epistatic relationships . Before phenotypic characterization, verification of the knockout should be confirmed at both DNA level (PCR) and protein level (Western blot). Phenotypic assays should include stress conditions (temperature, osmotic, oxidative) to reveal functions that might only be apparent under challenging environments. Additionally, complementation studies with the wild-type gene should be performed to confirm that observed phenotypes are directly attributable to ydfK loss.

How can native mass spectrometry be optimized for analyzing the oligomeric state of ydfK?

Native mass spectrometry (MS) offers powerful insights into the oligomeric state and interactions of membrane proteins like ydfK. Based on protocols used for similar membrane protein complexes, sample preparation for ydfK would begin with purification in a MS-compatible detergent or using the Peptidisc method for stabilization . For analysis, parameters should be optimized within specific ranges: m/z range of 5000-10000, Gaussian smoothing of 10.0, and a charge range of 10-30 would be appropriate starting points based on data from similar-sized membrane proteins . For spectral deconvolution, the UniDec algorithm with parameters similar to those used for other membrane proteins would be suitable: peak FWHM (Th) of 4.0, Gaussian peak shape function, and mass range appropriate to the expected size of ydfK and its potential oligomers . Critical to success is maintaining native conditions during ionization, using gentle collision energies, and careful calibration of the instrument. Comparison of spectra obtained under different conditions (pH, salt concentration, presence of potential binding partners) can reveal dynamic aspects of ydfK oligomerization.

What strategies can address common pitfalls in determining protein-protein interactions for membrane proteins like ydfK?

Determining protein-protein interactions for membrane proteins like ydfK presents unique challenges compared to soluble proteins. A multi-faceted approach is recommended, beginning with in vivo crosslinking to capture transient interactions within the native membrane environment. Techniques should be selected that maintain the integrity of the membrane environment, such as bacterial two-hybrid systems adapted for membrane proteins or split-protein complementation assays. Co-immunoprecipitation experiments should utilize mild detergents that maintain protein-protein interactions—including DDM at 0.02% or LDAO at 0.1%, which have proven effective for other membrane proteins . For identifying broader interaction networks, proximity-based labeling methods like BioID or APEX can be employed, where ydfK is fused to a biotin ligase that biotinylates proximal proteins. Finally, all putative interactions should be validated using orthogonal methods and negative controls, including testing interactions with unrelated membrane proteins to rule out non-specific hydrophobic interactions.

How can comparative genomics approaches be effectively utilized to predict ydfK function?

Comparative genomics represents a powerful approach for predicting functions of uncharacterized proteins like ydfK. The methodology should begin with comprehensive sequence similarity searches across diverse bacterial genomes, focusing particularly on other Gram-positive bacteria. Analysis should extend beyond simple sequence homology to examine synteny (conservation of gene order), which can reveal functional relationships even when sequence conservation is modest. Co-evolution analysis, which identifies proteins that show correlated evolutionary patterns with ydfK, can unveil functional relationships. Examination of gene neighborhood conservation can identify genes consistently found near ydfK orthologs, suggesting participation in common pathways. For maximum insight, these computational analyses should be integrated with experimental data, such as the phenotypic effects of ydfK deletion under various conditions. This integrated approach has proven effective in other bacterial systems, where uncharacterized genes were assigned to specific pathways based on a combination of computational predictions and targeted experimental validation.

How should contradictory experimental results regarding ydfK function be approached and resolved?

When confronted with contradictory results regarding ydfK function, researchers should implement a systematic troubleshooting approach. First, evaluate experimental conditions for variables that might explain discrepancies, including strain backgrounds, growth conditions, and experimental methodologies. Different B. subtilis strains can show varying phenotypes for the same mutation, as observed in recO research where phenotypic effects varied across epistatic groups . Second, consider whether the contradictions might reveal condition-specific functions of ydfK, particularly important for membrane proteins which often respond to environmental changes. Third, examine the specificity of the experimental techniques—some methods may detect direct effects while others capture indirect effects through cellular pathways. Fourth, implement orthogonal experimental approaches to triangulate the actual function; for example, if biochemical and genetic approaches yield different results, add structural or in vivo imaging methods. Finally, consider whether ydfK might have multiple functions depending on its interaction partners or cellular conditions, a common feature of membrane proteins. Throughout this process, maintain rigorous controls and transparent reporting of all variables to enable comprehensive analysis.

What are best practices for presenting membrane protein purification data in research publications?

Effective presentation of membrane protein purification data requires careful attention to both comprehensiveness and clarity. Data tables should present key parameters including buffer compositions, detergent concentrations, and column conditions used during each purification step . For ydfK purification, critical parameters to report include solubilization conditions (detergent type, concentration, temperature, duration), chromatography methods (column types, buffer compositions, elution conditions), and yield at each step . SDS-PAGE gel images should include molecular weight markers and demonstrate both purity and integrity of the protein. For membrane proteins like ydfK, additional characterization data is essential, including verification of proper folding (circular dichroism or fluorescence spectroscopy), oligomeric state (size exclusion chromatography, native PAGE, or analytical ultracentrifugation), and functionality (binding or activity assays if applicable). Data should be presented in standardized formats with appropriate statistical measures of reproducibility across multiple purification batches . Tables should be self-explanatory with comprehensive legends, allowing readers to replicate the purification process without referring to the main text.

What statistical approaches are most appropriate for analyzing differential expression of ydfK under various conditions?

For analyzing differential expression of ydfK under various experimental conditions, statistical approaches must account for the specific challenges of membrane protein expression data. When designing experiments, biological replicates (minimum n=3) are essential, with technical replicates nested within each biological replicate3. For comparing expression across multiple conditions, Analysis of Variance (ANOVA) followed by appropriate post-hoc tests (such as Tukey's HSD for all pairwise comparisons) should be employed rather than multiple t-tests, which inflate Type I error rates. If data do not meet parametric assumptions, nonparametric alternatives like Kruskal-Wallis with Dunn's post-hoc test are appropriate. For time-course expression studies, repeated measures ANOVA or mixed-effects models should be used to account for within-subject correlations. Regardless of the specific test, effect sizes (such as Cohen's d or partial eta-squared) should be reported alongside p-values to indicate biological significance. Data visualization should employ box plots or violin plots rather than bar graphs to display the full distribution of expression values. Finally, when multiple genes are being analyzed simultaneously, appropriate corrections for multiple comparisons (such as Benjamini-Hochberg procedure) should be applied to control false discovery rates.

How can the Peptidisc method be optimized specifically for ydfK stabilization and functional studies?

The Peptidisc method offers significant advantages for stabilizing membrane proteins like ydfK without requiring additional lipids, making it an ideal choice for functional studies . To optimize this method specifically for ydfK, several parameters should be systematically adjusted. First, the peptide-to-protein ratio should be titrated to determine optimal coverage while avoiding excess peptide that might interfere with functional assays. For medium-sized membrane proteins, starting ratios of 1:10 to 1:30 (protein:peptide) are recommended . Second, reconstitution conditions including buffer composition, ionic strength, and pH should be optimized to maintain ydfK stability and function. Third, researchers should compare multiple reconstitution approaches—"on-column," "in-gel," and "on-bead"—to determine which yields the most functional ydfK . For functional assays, the Peptidisc method is particularly advantageous as it maintains the protein in a water-soluble particle while preserving the native conformation of transmembrane segments. This allows for solution-based assays that would be impossible with detergent-solubilized protein or requires specialized techniques with proteoliposomes. The effectiveness of the optimized protocol should be verified using functional assays specific to the predicted role of ydfK.

What are the most promising approaches for determining the three-dimensional structure of ydfK?

For determining the three-dimensional structure of an uncharacterized membrane protein like ydfK, a multi-technique approach offers the highest probability of success. Cryo-electron microscopy (cryo-EM) represents perhaps the most promising primary approach, as it can resolve structures of membrane proteins without crystallization and has fewer size constraints than NMR. For cryo-EM studies, ydfK should be stabilized in Peptidiscs rather than detergent micelles to provide a more defined and homogeneous sample . If the protein is relatively small (<100 kDa), consider using Fab fragments as size enhancers to improve particle picking and alignment. X-ray crystallography remains valuable but requires extensive screening of crystallization conditions—typically hundreds to thousands of conditions with various detergents, lipids, and stabilizing agents. For crystallography, techniques like lipidic cubic phase crystallization often yield better results for membrane proteins than traditional vapor diffusion methods. Complementary structural information can be obtained from hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map solvent-accessible regions and crosslinking mass spectrometry (XL-MS) to determine distance constraints. Integrating data from multiple structural approaches provides the most comprehensive and reliable structural model.

How might knowledge of ydfK structure and function contribute to broader understanding of bacterial membrane biology?

Characterization of ydfK has significant potential to advance our understanding of bacterial membrane biology in several key areas. As an uncharacterized membrane protein in B. subtilis, ydfK likely participates in critical cellular processes that remain poorly understood. Based on research approaches used for other B. subtilis proteins, ydfK could be involved in stress response pathways, similar to how recO functions in DNA repair mechanisms . Understanding ydfK's role could reveal new insights into how bacteria sense and respond to environmental changes through membrane-associated signaling networks. Furthermore, if ydfK is conserved across different bacterial species, its characterization could identify novel membrane protein families with previously unrecognized functions. From a methodological perspective, developing effective approaches for ydfK study will advance techniques for characterizing other difficult membrane proteins . The knowledge gained may also have practical applications in biotechnology, as B. subtilis is widely used as a protein expression host and cell factory. Understanding the function of all membrane components, including ydfK, could lead to engineered strains with improved properties for protein production or bioremediation applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.