Recombinant Bacillus subtilis Uncharacterized membrane protein ydjJ (ydjJ)

Shipped with Ice Packs
In Stock

Description

Introduction to Bacillus subtilis Membrane Proteins

Bacillus subtilis serves as a model organism for gram-positive bacteria with significant contributions to our understanding of bacterial physiology, genetics, and protein secretion mechanisms. The bacterial membrane contains numerous proteins with diverse functions ranging from transport to signaling and energy production. Many of these membrane proteins remain uncharacterized or partially characterized, with their functions inferred through homology or preliminary studies rather than comprehensive functional analyses.

Among the membrane proteins in B. subtilis, several have been classified as "uncharacterized," indicating that while their sequences have been determined through genomic analyses, their precise biological functions remain undefined. The ydjJ protein represents one such uncharacterized membrane protein that is available as a recombinant product for research purposes .

Unlike some other B. subtilis membrane proteins that have been extensively studied, such as SpoIIIJ and YqjG (which function in membrane protein biogenesis), ydjJ remains relatively unexplored in the scientific literature . This gap presents both challenges and opportunities for researchers interested in bacterial membrane protein biology.

Biochemical Characteristics of ydjJ Membrane Protein

The ydjJ protein is cataloged in the UniProt database with the accession number O34733, identifying it as an uncharacterized membrane protein from Bacillus subtilis strain 168 . While the complete amino acid sequence is not provided in the available search results, the protein is described as being available in a partial form as a recombinant product, suggesting either limitations in expression of the full protein or specific research interests in particular domains of the protein.

The commercial availability of ydjJ as a recombinant protein indicates that it can be expressed in heterologous systems, specifically in E. coli as indicated in the product information . This suggests that despite potential challenges associated with membrane protein expression, the ydjJ protein or partial segments of it can be produced in quantities sufficient for research applications.

Recombinant Production and Properties

The recombinant form of ydjJ is commercially available with specific product codes (CSB-EP521996BRJ1) from suppliers specializing in research reagents . The production of this recombinant protein involves expression in E. coli systems, a common approach for generating bacterial proteins for research purposes.

The commercially available recombinant ydjJ protein demonstrates the following characteristics:

PropertyDescription
Product CodeCSB-EP521996BRJ1
Expression SystemE. coli
Purity>85% (as determined by SDS-PAGE)
Protein LengthPartial (not full-length)
UniProt AccessionO34733
Storage Recommendation-20°C/-80°C
Shelf Life (Liquid Form)6 months at -20°C/-80°C
Shelf Life (Lyophilized Form)12 months at -20°C/-80°C

The recombinant protein requires specific handling procedures to maintain its stability and functionality. Recommendations for reconstitution include using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage. The default final concentration of glycerol suggested for storage is 50% . Additionally, repeated freezing and thawing is not recommended, and working aliquots can be stored at 4°C for up to one week .

These specifications suggest that the recombinant ydjJ protein exhibits stability characteristics typical of membrane proteins, requiring careful handling to prevent denaturation or aggregation that might compromise its structural integrity and potential functional applications.

Comparative Analysis with Other B. subtilis Membrane Proteins

While specific information about ydjJ is limited, contextualizing it within the broader spectrum of B. subtilis membrane proteins provides valuable insights. Several other membrane proteins from B. subtilis have been better characterized and can serve as reference points for understanding the potential significance of ydjJ.

SpoIIIJ and YqjG: Well-Characterized Membrane Protein Insertases

In contrast to ydjJ, the B. subtilis membrane proteins SpoIIIJ and YqjG have been extensively studied. These proteins function as homologs of the YidC/Oxa1p/Alb3 family, which are involved in membrane protein biogenesis across all domains of life . Studies have demonstrated that SpoIIIJ and YqjG are functionally interchangeable in many contexts, though SpoIIIJ has a specific role in spore formation .

SpoIIIJ and YqjG have been shown to functionally complement the YidC protein in Escherichia coli, facilitating the membrane insertion of subunits of the cytochrome o oxidase and F₁F₀ ATP synthase complexes . This functionality extends to both SecYEG-dependent and -independent membrane insertion pathways .

While no direct functional relationship between ydjJ and these better-characterized proteins has been established in the available research, the methodologies employed in studying SpoIIIJ and YqjG could potentially be applied to elucidate the function of ydjJ.

Comparison with Other Uncharacterized B. subtilis Proteins

Several other uncharacterized proteins from B. subtilis are also commercially available as recombinant products, including:

  1. Uncharacterized deacetylase yojG

  2. Uncharacterized HTH-type transcriptional regulator ydgJ

These proteins, like ydjJ, represent components of the B. subtilis proteome that have been identified through genomic analysis but lack comprehensive functional characterization. The HTH-type transcriptional regulator ydgJ, for instance, is available as a full-length recombinant protein (164 amino acids) with a defined sequence suggesting a role in transcriptional regulation .

The comparative analysis of these uncharacterized proteins reveals a pattern in B. subtilis research where genomic sequencing has outpaced functional characterization, resulting in numerous identified proteins with undetermined biological roles.

Potential Functional Implications and Research Applications

Despite the limited specific information about ydjJ's function, several potential research applications and functional implications can be proposed based on its classification as a membrane protein in B. subtilis.

Membrane Protein Biogenesis Studies

Given the significance of other B. subtilis membrane proteins like SpoIIIJ and YqjG in membrane protein biogenesis, ydjJ could potentially play a role in similar processes. Research has shown that SpoIIIJ and YqjG facilitate membrane insertion of proteins in both B. subtilis and heterologous systems . Investigating whether ydjJ participates in analogous processes could provide insights into the diversity of membrane protein insertion mechanisms in bacteria.

Potential Role in Energy Metabolism

The association of SpoIIIJ and YqjG with the F₁F₀ ATP synthase complex suggests involvement in energy metabolism . While no direct connection has been established between ydjJ and energy-producing complexes, its membrane localization makes such an association plausible and worthy of investigation.

Applications in Biotechnology

Recombinant membrane proteins from B. subtilis have potential applications in biotechnology, including:

  • Development of antimicrobial targets, given the significance of membrane proteins in bacterial survival

  • Protein engineering for enhanced secretion or membrane integration in industrial strains

  • Structural studies to enhance our understanding of membrane protein topology and function

The availability of recombinant ydjJ facilitates such investigations, providing researchers with access to this otherwise challenging-to-isolate membrane protein.

Methods for Studying Uncharacterized Membrane Proteins

The study of uncharacterized membrane proteins like ydjJ typically employs a multifaceted approach combining various techniques:

Functional Complementation

As demonstrated with SpoIIIJ and YqjG, functional complementation studies in heterologous systems can reveal whether ydjJ can substitute for known membrane proteins in other organisms . This approach could help classify ydjJ within established functional categories.

Protein-Protein Interaction Studies

Co-purification and interaction studies, such as those revealing the association of SpoIIIJ and YqjG with the F₁F₀ ATP synthase complex, could identify potential binding partners for ydjJ, providing clues to its function .

Genomic Context Analysis

Examining the genomic environment of the ydjJ gene might reveal co-regulated genes or operonic structures that suggest functional relationships.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ydjJ; BSU06220; Uncharacterized membrane protein YdjJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ydjJ
Target Protein Sequence
MNEGYIIAGLLLLTAGMIDFLWTTLWLESGAGPITRCLSAWLWKGCRKISGDHAKVLSMA GPLLLCLTLVIWISLFWSGWVLIYSSDPHSLMETQSKEPASWSDRIYFSGYVMFTLGNGD LAPNGGLWKLVTIIETAQGLLTITFSVTYLISVLSAVNQKRSFAQSVLSLGHDGTEIVHN AWNGKDFHDIDFLLVAASSELGKLTAQHNAFPILHFYHSTQHQESSIIAVAVLDEALTIF KYGIPEQYQPNQLHIKEARSSIKNYLDTVHTAYIHPAEQAPPEPDISKLQQSGIPALSKQ TFQIAVNSIKERRQLLLGIIQAGARKWPVQEQAIGNAYSPK
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the membrane protein ydjJ in Bacillus subtilis?

Bacillus subtilis ydjJ is classified as an uncharacterized membrane protein with limited functional annotation. While commercial sources offer recombinant versions of this protein for research purposes , its physiological role remains largely undetermined. Current evidence suggests it contains transmembrane domains similar to other bacterial membrane proteins. Unlike well-characterized membrane proteins such as YqjD in E. coli (which functions as an inner membrane protein associated with ribosomes during stationary phase) , ydjJ's specific biological function awaits elucidation through targeted studies.

Researchers should approach ydjJ as a protein of interest within the broader context of B. subtilis as a model Gram-positive bacterium widely used for exploring questions across bacterial cell biology and industrial applications .

What methods are most effective for expressing and purifying recombinant ydjJ?

Expression and purification of membrane proteins like ydjJ present unique challenges. Based on approaches used for similar bacterial membrane proteins, researchers should consider:

Expression SystemAdvantagesChallengesBest For
Native B. subtilisNatural processing, physiological relevanceLower yields, endogenous competing proteinsFunctional studies
E. coliHigh yields, well-established protocolsPotential folding differences, toxicityInitial characterization
Cell-free systemsAvoids toxicity issues, direct accessHigher cost, complex optimizationDifficult-to-express variants

For purification, a combined approach using differential centrifugation (as described for YqjD in E. coli) followed by affinity chromatography with a fusion tag is recommended. Researchers should incorporate detergent screening to identify optimal conditions for maintaining protein stability and native conformation during purification.

How can researchers predict structural features of ydjJ?

In the absence of experimental structural data, computational approaches offer valuable insights into ydjJ structure:

  • Transmembrane domain prediction using tools similar to the SOSUI system (http://bp.nuap.nagoya-u.ac.jp/sosui/) that successfully identified transmembrane motifs in YqjD

  • Sequence homology analysis with characterized membrane proteins

  • Secondary structure prediction algorithms

  • Hydrophobicity analysis to identify potential membrane-spanning regions

Researchers should validate these predictions through experimental approaches like site-directed mutagenesis of predicted functional residues or limited proteolysis to identify domain boundaries.

What techniques can determine the subcellular localization of ydjJ?

To establish the precise localization of ydjJ within B. subtilis cells, researchers should employ multiple complementary approaches:

  • Differential centrifugation followed by western blot analysis, similar to methods used for YqjD localization . This approach involves:

    • Cell lysis under gentle conditions

    • Sequential centrifugation steps to separate cellular fractions

    • Identification of target protein in membrane fractions using specific antibodies

  • Fluorescence microscopy with fluorescently tagged ydjJ constructs, being mindful that tags may affect localization

  • Genetic code expansion incorporating click-chemistry compatible non-standard amino acids (nsAAs) for in situ labeling, as demonstrated successfully in B. subtilis

  • Protease accessibility assays to determine membrane topology (which protein regions face cytoplasm versus extracellular space)

How can genetic code expansion be applied to study ydjJ function?

Recent work has demonstrated successful genetic code expansion in B. subtilis, which provides powerful tools for studying membrane proteins like ydjJ . Researchers can:

  • Incorporate photocrosslinking nsAAs to identify protein-protein interaction partners in vivo

  • Use click-chemistry compatible nsAAs for fluorescent labeling to track protein localization

  • Introduce nsAAs for translational titration to precisely modulate ydjJ levels

  • Employ metal-chelating nsAAs to probe potential metal binding sites

The incorporation of these nsAAs can be achieved using aminoacyl-tRNA synthetase/tRNA pairs that have demonstrated activity in B. subtilis, such as the MjTyrRS family or PylRS systems . This approach has been validated for incorporating up to 20 distinct nsAAs in B. subtilis, covering most applications of genetic code expansion .

What approaches are recommended for identifying potential interacting partners of ydjJ?

Identifying protein interaction partners is crucial for understanding the function of uncharacterized proteins like ydjJ:

TechniquePrincipleAdvantagesLimitations
Co-immunoprecipitationAntibody-based pulldownWorks in native conditionsRequires specific antibody
Bacterial two-hybridProtein interaction reconstitutes reporter activityIn vivo detectionPotential false positives
PhotocrosslinkingUV-activated crosslinker captures transient interactionsCaptures weak/transient interactionsRequires genetic code expansion
Proximity labelingEnzymatic labeling of nearby proteinsMaps spatial proteomeMay capture non-interacting proximal proteins

For membrane proteins specifically, photocrosslinking using genetic code expansion to incorporate crosslinking nsAAs is particularly valuable, as demonstrated in B. subtilis . This approach can validate predicted protein-protein binding interfaces and capture transient interactions that might be lost in traditional pulldown approaches.

How can researchers analyze cotranslational membrane integration of ydjJ?

Understanding how membrane proteins like ydjJ integrate into lipid bilayers during translation provides insights into folding mechanisms and structural constraints. Researchers can apply residue-by-residue analysis techniques similar to those used for other membrane proteins :

  • Generate translation arrest peptide (AP) constructs of varying lengths

  • Analyze force profiles (FPs) to identify integration events

  • Use mutations to confirm specific residue contributions to membrane integration

  • Compare experimental data with computational molecular dynamics simulations

These approaches allow identification of transmembrane segments and determination of when each segment engages with the membrane during translation. For example, studies of other membrane proteins have shown that integration of a transmembrane helix typically begins when its N-terminal end is approximately 45-50 residues away from the polypeptide transferase center .

What tools can distinguish between direct functional effects and pleiotropic consequences when manipulating ydjJ?

When genetically manipulating an uncharacterized protein like ydjJ, distinguishing direct functional effects from secondary consequences presents significant challenges:

  • Use inducible expression systems that allow titration of protein levels, similar to translational titration systems employed in genetic code expansion studies

  • Create point mutations targeting specific domains rather than complete knockouts

  • Implement time-resolved studies to distinguish immediate versus delayed phenotypic changes

  • Design complementation experiments with:

    • Wild-type protein

    • Domain-specific mutants

    • Heterologous proteins with similar predicted functions

  • Apply comparative transcriptomics and proteomics to identify pathways affected by ydjJ manipulation, distinguishing primary from secondary effects through temporal analysis

The integration of these approaches provides stronger evidence for direct functional relationships versus pleiotropic effects.

How might regulation of ydjJ expression compare to other bacterial membrane proteins?

Based on studies of other bacterial membrane proteins, researchers investigating ydjJ regulation should consider:

  • Growth phase-dependent expression, similar to YqjD in E. coli which shows stationary phase-specific expression

  • Stress response regulation - examine whether ydjJ expression is controlled by stress response sigma factors comparable to RpoS regulation of YqjD

  • Nutritional regulation - test whether specific nutrient limitations alter expression patterns

  • Post-transcriptional regulation through ribosome binding and translation efficiency

To investigate these possibilities, researchers should employ:

  • Promoter-reporter fusion constructs

  • qRT-PCR across different growth conditions

  • Western blotting with growth phase-specific sampling

  • Genetic approaches testing expression in relevant regulatory mutants (e.g., sigma factor mutants)

How should researchers approach contradictory results when studying uncharacterized proteins like ydjJ?

Contradictory results are common when studying uncharacterized proteins and require systematic evaluation:

  • Methodological differences:

    • Compare experimental conditions between contradictory studies

    • Evaluate differences in protein constructs (e.g., tags, truncations)

    • Assess strain background variations

  • Biological explanations:

    • Consider context-dependent protein functions

    • Evaluate potential moonlighting activities

    • Investigate strain-specific effects

  • Technical validation:

    • Confirm protein expression and localization in each experimental system

    • Validate reagent specificity (especially antibodies)

    • Employ orthogonal methods to test key findings

When reporting such contradictions, researchers should explicitly discuss potential sources of variation and design experiments that directly test competing hypotheses.

What statistical approaches are recommended for analyzing ydjJ functional data?

Data TypeRecommended Statistical ApproachImplementation Notes
Expression levelsANOVA with post-hoc testsAccount for technical and biological replicates separately
Localization patternsQuantitative image analysis with mixed-effects modelsControl for cell-to-cell variability
Interaction studiesSignificance analysis with multiple testing correctionCompare to appropriate negative controls
Phenotypic assaysNon-parametric tests when distributions unknownReport effect sizes, not just p-values

For membrane proteins specifically, researchers should consider statistical approaches that account for the unique challenges of membrane protein analysis, including detergent effects, extraction efficiency variation, and expression level heterogeneity.

How does characterization of ydjJ contribute to broader understanding of Bacillus subtilis biology?

Characterizing uncharacterized membrane proteins like ydjJ advances B. subtilis research in several dimensions:

  • Membrane biology: Completes our understanding of the membrane proteome, which is essential for cellular compartmentalization, transport, and signaling

  • Evolutionary insights: Provides data for comparative analysis with other bacterial species, potentially revealing conserved mechanisms

  • Stress response networks: May uncover novel components in stress adaptation pathways, particularly if ydjJ shows regulation patterns similar to YqjD in E. coli

  • Biotechnological applications: Expands the toolkit of characterized components for synthetic biology applications in this industrially important organism

  • Antimicrobial development: Identifies potential new targets for antimicrobials against Gram-positive pathogens related to B. subtilis

Each uncharacterized protein that becomes functionally annotated fills critical knowledge gaps in our understanding of bacterial physiology and evolution.

How can genetic code expansion methods improve structural studies of membrane proteins like ydjJ?

Genetic code expansion offers powerful approaches for structural investigation of challenging membrane proteins like ydjJ :

  • Site-specific incorporation of spectroscopic probes for distance measurements and conformational analysis

  • Introduction of heavy atoms at specific positions to aid crystallographic phasing

  • Incorporation of photocrosslinking nsAAs to capture and identify transient interaction states

  • Installation of environmentally sensitive fluorophores to report on local conformational changes

  • Creation of click chemistry handles for attaching various biophysical probes post-translationally

These methods overcome traditional challenges in membrane protein structural biology by enabling precise modification at any position without relying solely on natural amino acid chemistry. Recent demonstrations of efficient genetic code expansion in B. subtilis make these approaches immediately applicable to ydjJ research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.