Recombinant Bacillus subtilis Uncharacterized membrane protein ylaH (ylaH)

Shipped with Ice Packs
In Stock

Description

Recombinant Bacillus subtilis Uncharacterized Membrane Protein ylaH (ylaH): Overview

Recombinant Bacillus subtilis Uncharacterized membrane protein ylaH (ylaH) is a transmembrane protein produced through recombinant DNA technology. Despite its classification as "uncharacterized," structural and biochemical data provide insights into its properties and potential roles. Below is a synthesis of available research findings and technical specifications.

Sequence and Molecular Weight

  • Sequence: MNDVSERLSF FAALYQVDRQ PAAGMWLLYG TIFVLAVIVF KLGFAKRLPV LKSAVVYVFL ALGCTVLTFL GVFLPVAEGL VVAALILIIY KIRLYQSKKG QSAKS (1–105 amino acids) .

  • Molecular Weight: 11,560 Da, as determined by SDS-PAGE .

Membrane Localization

  • Transmembrane Domain: Predicted to span the membrane based on sequence analysis, though experimental confirmation is lacking .

  • Host System: Expressed in a cell-free expression system, bypassing traditional host-cell-based production methods .

Expression System

  • Method: Cell-free expression, likely using E. coli lysates or in vitro translation systems, though specific host details are not provided .

  • Purity: ≥85% as verified by SDS-PAGE (lot-specific) .

Hypothetical Roles

  • Membrane Protein Biogenesis: While B. subtilis employs proteins like SpoIIIJ and YqjG (YidC homologs) for membrane protein insertion , ylaH’s role remains unexplored.

  • Spore Formation: Unlike YaaH, which is linked to spore germination , ylaH lacks documented involvement in sporulation or germination pathways.

Comparative Context

  • Uncharacterized Proteins in B. subtilis:

    ProteinLocalizationExpression SystemFunction
    ylaHTransmembraneCell-freeUnknown
    yvbJMembraneHost-cell (e.g., E. coli)Unknown
    yckCMembraneHost-cellUnknown

Source: Adapted from .

Potential Uses

  • Research Tool: As a recombinant protein, ylaH may serve as a model for studying membrane protein folding, insertion, or interactions in B. subtilis.

  • Biotechnological Platforms: Leveraging B. subtilis’ GRAS status, ylaH could be integrated into secretion systems for producing bioactive compounds .

Research Priorities

  1. Functional Elucidation: Knockout studies or biochemical assays to determine interactions with known membrane complexes (e.g., F₁F₀ ATP synthase ).

  2. Localization Studies: Fluorescence or electron microscopy to confirm membrane localization.

  3. Homology Analysis: Comparative genomics to identify conserved domains or orthologs in other organisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes to ensure fulfillment of your request.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped standard with blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ylaH; BSU14780; Uncharacterized membrane protein YlaH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ylaH
Target Protein Sequence
MNDVSERLSFFAALYQVDRQPAAGMWLLYGTIFVLAVIVFKLGFAKRLPVLKSAVVYVFL ALGCTVLTFLGVFLPVAEGLVVAALILIIYKIRLYQSKKGQSAKS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the ylaH protein in Bacillus subtilis?

The ylaH protein in Bacillus subtilis is an uncharacterized membrane protein with limited functional data available. Current genomic analysis suggests it may be involved in cell envelope maintenance, similar to other membrane proteins in B. subtilis. Expression studies indicate that ylaH is expressed under standard laboratory growth conditions, with potential regulation during stress responses. The protein contains predicted transmembrane domains typical of integral membrane proteins, though its exact topology remains to be experimentally verified. Comparative genomic analyses suggest conservation among closely related Bacillus species, indicating potential evolutionary importance. Preliminary studies suggest possible interactions with cell wall synthesis machinery, though these findings require further validation with targeted experimental approaches.

What expression systems are recommended for recombinant production of ylaH?

For successful recombinant expression of the ylaH membrane protein, several expression systems can be employed based on research objectives. The E. coli BL21(DE3) strain with pET vector systems provides high-yield expression when coupled with membrane protein-specific modifications. Specifically, C41(DE3) and C43(DE3) strains, which are derivatives of BL21(DE3), have shown improved tolerance for membrane protein expression. For maintaining native folding, the B. subtilis expression system using the SURE expression vectors is recommended, particularly when functional studies are prioritized over yield. Growth conditions significantly impact expression efficiency - cultivation at lower temperatures (16-20°C) after induction, rather than standard 37°C, reduces inclusion body formation. Addition of glycerol (5-10%) to cultivation media can stabilize membrane proteins during expression. For difficult-to-express membrane proteins like ylaH, cell-free expression systems represent an alternative approach that bypasses toxicity issues often encountered with membrane protein overexpression.

How can I verify successful expression of recombinant ylaH protein?

Verification of recombinant ylaH expression requires a multi-technique approach due to the challenges associated with membrane protein detection. Western blotting using antibodies against the fusion tag (His, FLAG, or other epitope tags) provides the most reliable verification method. When performing Western blots, membrane fraction preparation is critical - standard protocols using ultracentrifugation (100,000 × g for 1 hour) following cell lysis are recommended for proper membrane protein enrichment. Coomassie-stained SDS-PAGE may not provide sufficient sensitivity for detection unless expression levels are exceptionally high. Fluorescence microscopy using GFP-fusion constructs offers an alternative verification method, particularly valuable for localization studies. For quantitative assessment, mass spectrometry of purified membrane fractions can confirm expression and provide precise quantification. When performing these verifications, inclusion of appropriate positive and negative controls is essential to distinguish true expression from background signals common in membrane preparations.

What are the optimal detergents for solubilizing and purifying ylaH protein?

The selection of appropriate detergents is critical for successful solubilization and purification of ylaH membrane protein. A systematic detergent screening approach is recommended, testing multiple detergent classes at varying concentrations. Non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) at 1-2% concentration have shown effectiveness for many Bacillus membrane proteins, providing a good starting point. For more challenging solubilization, zwitterionic detergents such as LDAO (lauryldimethylamine oxide) at 0.5-1% can be employed. The following table presents recommended detergent screening conditions:

Detergent ClassSpecific DetergentTest Concentration RangeSolubilization Conditions
Non-ionicDDM0.5-2%4°C, 2 hours, gentle rotation
Non-ionicTriton X-1000.5-2%4°C, 2 hours, gentle rotation
ZwitterionicLDAO0.2-1%4°C, 2 hours, gentle rotation
ZwitterionicCHAPS0.5-2%4°C, 2 hours, gentle rotation
Mild IonicSodium cholate0.5-1.5%4°C, 2 hours, gentle rotation

After initial solubilization, detergent concentration should be reduced to just above the critical micelle concentration during purification steps to maintain protein stability while minimizing excess detergent. Protein stability in each detergent should be assessed through time-course experiments monitoring aggregation by size exclusion chromatography. For functional studies, detergent exchange into lipid nanodiscs or proteoliposomes may be necessary to recreate a native-like membrane environment.

How can I optimize affinity purification protocols for ylaH protein?

Optimizing affinity purification for membrane proteins like ylaH requires several specific considerations beyond standard protocols. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with the following modifications is recommended: include the selected detergent at 2-3× its critical micelle concentration in all buffers; use extended binding times (1-2 hours at 4°C with gentle agitation rather than standard flow-through); and employ a shallow imidazole gradient (20-300 mM) for elution to improve separation of non-specific binders. When multiple purification steps are necessary, size exclusion chromatography (SEC) as a second step helps remove aggregates and verify protein monodispersity. For challenging purifications, consider alternative tags such as Strep-tag II or FLAG-tag, which sometimes provide higher specificity for membrane proteins. Buffer optimization is equally important - inclusion of glycerol (10-20%) and reducing agents (5 mM DTT or 2 mM β-mercaptoethanol) improves stability during purification. Protein concentration steps should utilize centrifugal concentrators with higher molecular weight cutoffs (50-100 kDa) than the protein size would normally require, as detergent micelles increase the effective molecular weight.

What approaches can improve the stability of purified ylaH for structural studies?

Maintaining stability of purified ylaH protein for structural studies requires specialized approaches addressing the unique challenges of membrane proteins. Systematic buffer optimization through thermal shift assays (TSA) or differential scanning fluorimetry (DSF) can identify stabilizing conditions. Critical parameters to screen include: pH range (6.0-8.5), salt concentration (100-500 mM NaCl), and various additives. The following stabilizing additives have proven effective for Bacillus membrane proteins:

Additive CategorySpecific CompoundEffective Concentration RangeMechanism of Stabilization
PolyolsGlycerol10-25%Prevents aggregation, reduces water activity
SugarsSucrose5-15%Preferential hydration, reduces unfolding
LipidsE. coli polar lipid extract0.1-0.5 mg/mlProvides native-like environment
Cholesterol derivativesCholesteryl hemisuccinate0.1-0.5 mMStabilizes membrane protein interfaces
Metal ionsZinc chloride10-100 μMStabilizes specific structural domains

For long-term stability, flash-freezing small aliquots in liquid nitrogen after addition of 10% glycerol prevents repeated freeze-thaw cycles. For crystallography attempts, lipidic cubic phase (LCP) or lipid nanodiscs may provide superior environments compared to detergent micelles. Engineering approaches, such as introducing disulfide bonds or thermostabilizing mutations based on homology modeling, can be explored for proteins resistant to standard stabilization techniques.

How can I perform effective topology mapping of ylaH in the membrane?

Topology mapping of membrane proteins like ylaH requires systematic experimental approaches to determine transmembrane segment orientation and membrane insertion. Cysteine scanning mutagenesis combined with thiol-specific labeling provides residue-level accessibility data. In this approach, single cysteine residues are introduced throughout the protein sequence and their accessibility to membrane-impermeable (e.g., MTSET) versus membrane-permeable (e.g., NEM) thiol-reactive reagents is assessed. Protease protection assays using proteases like trypsin or chymotrypsin on intact membrane vesicles can identify cytoplasmic versus periplasmic/extracellular domains. Fluorescence techniques utilizing position-specific GFP fusions or environmentally sensitive fluorophores provide complementary data on domain localization. For higher throughput assessment, the following dual-reporter fusion system has proven effective:

Position in SequenceN-terminal ReporterC-terminal ReporterExpected Result for Cytoplasmic DomainExpected Result for Extracellular Domain
N-terminusNonePhoA or GFPHigh GFP / Low PhoA signalLow GFP / High PhoA signal
Internal loopPhoA or GFPPhoA or GFPResults pattern indicates orientationResults pattern indicates orientation
C-terminusPhoA or GFPNoneHigh GFP / Low PhoA signalLow GFP / High PhoA signal

Results from these complementary approaches should be integrated with computational predictions from algorithms like TMHMM, TOPCONS, or DeepTMHMM to generate consensus topology models.

What crystallization strategies are most appropriate for ylaH membrane protein?

Crystallization of membrane proteins like ylaH presents significant challenges requiring specialized approaches beyond standard soluble protein methods. Lipidic cubic phase (LCP) crystallization has emerged as particularly successful for bacterial membrane proteins, providing a native-like lipid bilayer environment. When implementing LCP crystallization, systematic screening of different lipids (including monoolein, monopalmitolein, and various phospholipid additives) is recommended. For traditional vapor diffusion approaches, detergent screening is critical - smaller micelle-forming detergents like octyl glucoside or LDAO often produce better-diffracting crystals than larger detergents like DDM. Antibody fragment (Fab) or nanobody co-crystallization can provide additional hydrophilic surfaces and stabilize specific conformations. The following crystallization parameters have proven particularly important for Bacillus membrane proteins:

ParameterRecommended StrategyRationale
Protein purity>95% monodispersity by SECHeterogeneity prevents crystal formation
Protein concentration5-15 mg/mlConcentration-dependent micelle effects
Temperature4°C and 20°C parallel screensTemperature affects phase separation kinetics
AdditivesLipids, cholesterol derivativesStabilizes native-like conformation
PrecipitantsPEG 400-4000, ammonium sulfateEffective for membrane protein crystallization
Crystallization scaleNano-volume automated dispensingConserves protein, increases condition screening

Microcrystals obtained from initial screening can be improved through seeding techniques, additive screening, and careful optimization of crystallization kinetics through manipulation of drop ratios and equilibration rates.

What assays can determine if ylaH has enzymatic activity?

Determining potential enzymatic activity of uncharacterized membrane proteins like ylaH requires systematic screening approaches. Based on bioinformatic predictions and structural similarities to characterized proteins, candidate enzymatic activities should be tested using multiple complementary methods. For decarboxylase activity assessment (similar to YisK in B. subtilis), spectrophotometric assays measuring substrate depletion or product formation provide quantitative data . Coupled enzyme assays linking potential ylaH activity to detectable reporter reactions (color change, fluorescence, or luminescence) offer increased sensitivity. Mass spectrometry-based assays can directly measure substrate consumption and product formation without requiring coupled reactions. When designing assay conditions, the following parameters should be systematically varied:

ParameterRecommended Variation RangeConsideration
pH5.0-9.0 in 0.5 unit incrementsMembrane proteins often have pH optima different from cytosolic enzymes
Temperature25°C, 30°C, 37°C, 42°CTest physiologically relevant range plus stress conditions
Divalent cationsMg²⁺, Mn²⁺, Ca²⁺, Zn²⁺ at 1-10 mMMany membrane enzymes require specific metal cofactors
Substrate concentration10 μM to 10 mMWide range to account for potential high Km values
Detergent/lipid environmentDetergent micelles, nanodiscs, proteoliposomesNative-like environment may be required for activity

For thorough characterization, kinetic parameters (Km, Vmax, kcat) should be determined under optimized conditions, and substrate specificity profiles established by testing structurally related compounds.

How can I determine if ylaH functions as a transporter?

Characterizing potential transport function of ylaH requires specialized methodologies that maintain membrane integrity while measuring substrate movement. Reconstitution of purified ylaH into proteoliposomes represents the gold standard for transport assays, allowing precise control of buffer conditions on both sides of the membrane. Transport can be measured using radiolabeled substrates, fluorescent substrates, or substrate-specific electrodes. For high-throughput initial screening, the following experimental setup is recommended:

TechniqueSubstrate DetectionAdvantagesLimitations
Radioisotope fluxScintillation countingHigh sensitivity, quantitativeRequires specialized facilities, limited substrates
Fluorescent substrateFluorescence spectroscopyReal-time measurement, visual confirmationRequires fluorescent substrates or indicators
Ion-selective electrodesDirect electrical measurementContinuous monitoring, high temporal resolutionLimited to specific ions (H⁺, Na⁺, K⁺, Cl⁻)
Counterflow assaysVarious detection methodsTests exchange mechanismsComplex setup, indirect measurement

For whole-cell transport studies, B. subtilis strains with ylaH deletion compared to complemented strains can reveal physiological relevance of transport function. Membrane vesicle preparations offer an intermediate approach between whole cells and proteoliposomes. Transport inhibitor screening can provide insights into mechanism and substrate binding sites. For all transport characterization, proper controls including protein-free liposomes and heat-inactivated protein preparations are essential to distinguish specific transport from non-specific leakage.

What approaches can determine the role of ylaH in cell envelope maintenance?

Investigating ylaH's potential role in cell envelope maintenance requires multi-faceted approaches examining morphological, physiological, and molecular phenotypes. Comparison of wild-type, ylaH deletion mutant, and complemented strains provides the foundation for these studies. Microscopy-based techniques including phase contrast, fluorescence with membrane/cell wall dyes, and electron microscopy can reveal morphological abnormalities similar to those observed with Mbl and YisK in B. subtilis . Growth phenotype analysis under various stress conditions provides functional insights:

Stress ConditionConcentration RangePhenotype Assessment
Osmotic stress0.5-2.0 M NaClGrowth rate, lag phase, final density
Cell wall antibioticsSublethal concentrations (varies by antibiotic)MIC determination, growth inhibition zones
Membrane disrupting agentsSDS (0.001-0.1%), Triton X-100 (0.001-0.1%)Survival rates, morphological changes
Temperature stress16°C, 30°C, 42°C, 50°CGrowth kinetics across temperature range
Oxidative stressH₂O₂ (0.1-5 mM), paraquat (0.01-0.5 mM)Survival rates, ROS production

Molecular techniques including transcriptome analysis comparing wild-type and ylaH mutant strains can identify compensatory responses indicating the affected cellular processes. Cell wall composition analysis using HPLC or mass spectrometry can reveal specific biochemical changes. Peptidoglycan synthesis rate measurement using radiolabeled precursors provides direct functional assessment. Protein localization studies using fluorescent fusion proteins can determine if ylaH exhibits specific subcellular localization patterns similar to other cell envelope maintenance proteins.

How can I identify proteins that interact with ylaH in Bacillus subtilis?

Identifying interaction partners of membrane proteins like ylaH requires specialized approaches that maintain native membrane environments while enabling detection of potentially transient interactions. Co-immunoprecipitation (Co-IP) using epitope-tagged ylaH expressed at near-native levels provides a direct approach for identifying stable interactors. For Co-IP with membrane proteins, careful optimization of solubilization conditions is critical - crosslinking with formaldehyde (0.1-1%) prior to cell lysis can stabilize transient interactions. Proximity-based labeling techniques including BioID or APEX2 fused to ylaH offer advantages for detecting both stable and transient interactions in living cells. For these approaches, the following experimental design is recommended:

MethodTag/FusionExpression LevelDetection Method
Co-IP3×FLAG or 2×StrepNear-native (xylose-inducible promoter)Mass spectrometry of eluates
BioIDBioID2-ylaH fusionNear-nativeStreptavidin pulldown followed by MS
APEX2APEX2-ylaH fusionNear-nativeStreptavidin pulldown followed by MS
Crosslinking MSPhotoactivatable or chemical crosslinkersNative or near-nativeMS with specialized analysis
Bacterial two-hybridT18/T25 fusionsHeterologous expressionBlue/white screening, β-galactosidase assay

Validation of identified interactions should include reverse Co-IP, fluorescence colocalization, and functional studies such as epistasis analysis of respective gene deletions. For comprehensive interaction mapping, combining data from multiple complementary techniques provides the most reliable results.

What microscopy techniques are most effective for visualizing ylaH localization?

Visualizing the subcellular localization of ylaH requires microscopy techniques optimized for membrane protein detection with sufficient resolution to distinguish potential pattern formation. Fluorescent protein fusions (particularly msfGFP or mNeonGreen) provide the foundation for live-cell imaging, with careful consideration of fusion position (N-terminal, C-terminal, or internal) based on predicted topology. Super-resolution microscopy techniques offer significant advantages for detailed localization patterns:

Microscopy TechniqueResolution LimitAdvantages for ylaH LocalizationTechnical Considerations
Structured Illumination (SIM)~100 nmLive-cell compatible, 3D capabilityRequires bright fluorophores
Stochastic Optical Reconstruction (STORM)~20 nmHighest resolution, distinct clustersFixed samples, specialized dyes
Stimulated Emission Depletion (STED)~50 nmLive-cell compatible, good resolutionHigh laser power, photobleaching
Single-Molecule TrackingTracks to ~10 nmDynamics information, diffusion ratesComplex analysis, specialized setup
Cryo-Electron Tomography~3-5 nmUltrastructural contextFixed samples, specialized equipment

For optimal results, temporal studies examining localization throughout the cell cycle and under various growth conditions provide insights into dynamic behavior. Colocalization studies with known marker proteins for cell division (FtsZ), elongation (MreB, Mbl), secretion (SecA), or other cellular landmarks help establish functional context. For quantitative analysis, specialized image analysis tools for measuring cluster size, distribution patterns, and correlation with cell features should be employed.

How does ylaH localization change under different growth conditions?

The subcellular localization pattern of membrane proteins often provides critical insights into their function, with changes under different conditions revealing regulatory mechanisms. To comprehensively characterize ylaH localization dynamics, live-cell imaging of fluorescent protein fusions should be performed under systematically varied growth conditions, including:

Growth ConditionParameter RangeExpected Impact on Localization
Growth phaseLag, exponential, stationaryCell cycle-dependent patterns
Growth rateRich vs. minimal mediaCoordination with growth machinery
Cell wall stressSublethal antibiotic concentrationsPotential redistribution to repair sites
Temperature25°C, 37°C, 42°CStress response relocalization
Nutrient limitationCarbon, nitrogen, phosphateMetabolic state influence
Genetic backgroundsΔmbl, ΔmreB, ΔponA mutantsDependency on cytoskeletal elements

Time-lapse microscopy with automated image analysis allows quantification of dynamic changes, revealing potential oscillatory patterns or directed movement along cellular tracks. Correlative light and electron microscopy (CLEM) provides ultrastructural context for fluorescence observations. For proteins with complex localization patterns, photoactivatable fluorescent proteins enable pulse-chase experiments to track specific protein subpopulations. Comparisons with other membrane proteins from related functional pathways may reveal coordinated localization responses to specific cellular states or stresses.

How can I design a genetic suppressor screen to identify functional relationships for ylaH?

Genetic suppressor screens represent powerful approaches for uncovering functional relationships of uncharacterized proteins like ylaH. For membrane proteins involved in cell envelope processes, conditional lethal phenotypes often provide the most effective starting points. The following systematic approach is recommended:

First, establish a clear phenotype associated with ylaH deletion or overexpression - if deletion produces no obvious phenotype, construct a strain with controlled expression (depletion or overexpression) that exhibits growth defects under specific conditions. For suppressor screening, two complementary approaches should be employed: spontaneous suppressor isolation and targeted transposon mutagenesis. For spontaneous suppressor isolation, plate approximately 10⁸-10⁹ cells of the conditional strain under restrictive conditions, and sequence genomes of colonies that arise. For transposon mutagenesis:

StepMethodTechnical Considerations
Transposon library generationmariner-based transposons (high efficiency in B. subtilis)Ensure genome-wide coverage (>50,000 insertions)
Selection strategyPlate under conditions where ylaH mutant shows growth defectInclude appropriate controls to identify non-specific suppressors
Suppressor mappingTransposon-junction sequencing or whole genome sequencingCompare multiple independent suppressors to identify common pathways
ValidationClean deletion/overexpression of identified genesConfirm suppression is specific to ylaH phenotype
Mechanism investigationDouble mutant analysis, protein interaction studiesDetermine if suppression is direct or indirect

For comprehensive interpretation, suppressors should be categorized by functional pathways and validated through complementary approaches including protein-protein interaction studies and localization dependencies.

What approaches can resolve contradictory data about ylaH function?

Resolving contradictory data about membrane protein function requires systematic investigation of experimental variables that might explain discrepancies. When faced with contradictory findings regarding ylaH function, the following structured approach is recommended:

First, thoroughly document all experimental conditions associated with conflicting results, including strain backgrounds, expression systems, purification methods, and assay conditions. Genetic background differences often explain phenotypic variability in B. subtilis - sequence verification of the strain's genome can identify suppressor mutations or additional genetic changes. For biochemical characterization discrepancies:

Source of ContradictionInvestigation ApproachResolution Strategy
Protein preparation differencesSide-by-side comparison with varied detergents/lipidsIdentify stability-function relationships
Assay condition variationSystematic parameter screening (pH, salt, temperature)Generate comprehensive activity profiles
Expression level artifactsTitration experiments with controlled expressionDetermine physiologically relevant concentrations
Indirect vs. direct effectsSeparation of phenotypic from biochemical characterizationBuild integrated model accounting for both
Protein state heterogeneitySingle-molecule techniques, conformational analysisIdentify functionally distinct subpopulations

Collaborative cross-laboratory validation studies with standardized protocols can resolve persistent contradictions. When multiple functions are indicated by different studies, consider the possibility that ylaH may indeed be multifunctional, with context-dependent roles. Development of in vivo assays that specifically monitor the proposed functions can help determine their physiological relevance.

How can I integrate structural, functional, and localization data to build a comprehensive model of ylaH function?

Developing a comprehensive functional model for an uncharacterized membrane protein requires systematic integration of diverse experimental datasets. For ylaH, the following integration framework is recommended:

Begin with sequence-based bioinformatic analysis including evolutionary conservation patterns, predicted functional domains, and genomic context. Structural data, whether from experimental determination or computational prediction, provides the physical framework for understanding mechanism. Functional data from biochemical assays, genetic phenotypes, and physiological responses indicates potential activities. Localization and dynamics observations reveal spatial and temporal aspects of function. Protein-protein interactions establish the functional network context.

Data Integration ApproachMethodologyOutcome
Structure-function mappingSite-directed mutagenesis of predicted functional residuesValidation of mechanistic hypotheses
Multi-scale temporal analysisCorrelation of molecular events with cellular responsesEstablishment of causality chains
Comparative analysis across conditionsIdentification of consistent vs. context-dependent propertiesDifferentiation of core vs. conditional functions
Network-based integrationGraph theory approaches to interaction and genetic dataPositioning within cellular functional modules
Mathematical modelingOrdinary differential equations or agent-based modelsTestable predictions of system behavior

The resulting integrated model should make specific, testable predictions about ylaH function under new conditions not previously examined. Interdisciplinary collaboration bringing together structural biology, biochemistry, genetics, and systems biology perspectives can strengthen model development. The model should explicitly acknowledge remaining uncertainties and propose specific experiments to address them, maintaining scientific rigor while advancing understanding of this uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.