Recombinant Bacillus subtilis Uncharacterized membrane protein yndD (yndD)

Shipped with Ice Packs
In Stock

Description

Introduction to YndD Protein

YndD, officially designated as Uncharacterized membrane protein YndD, is encoded by the yndD gene in Bacillus subtilis. The protein is identified in the UniProt database with the accession number O31808 (YNDD_BACSU) and classified as a membrane protein . YndD consists of 520 amino acids, making it a relatively substantial membrane protein . The gene is referenced by Gene ID 939529 in genomic databases .

Bacillus subtilis, the organism in which YndD naturally occurs, serves as a model Gram-positive bacterium widely utilized in microbiological and biotechnological research. The primary strain in which YndD has been studied is Bacillus subtilis strain 168 . Notably, several proteins with identical sequences to YndD exist across different Bacillus subtilis strains, including:

  • Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 (A0AAX1EPZ1)

  • Bacillus subtilis (A0A6M3ZEP8, A0AAU8V9Y1)

  • Bacillus subtilis subsp. subtilis (A0AAE2SLB6)

This sequence conservation across multiple strains suggests YndD likely serves an important biological function, despite its current uncharacterized status. The protein's membrane localization indicates potential involvement in critical cellular processes such as transport, signaling, or membrane protein biogenesis.

Recombinant Production and Purification Methods

Recombinant production of YndD involves expressing the yndD gene in heterologous host organisms to facilitate protein purification, characterization, and functional analysis. This approach enables researchers to obtain YndD in quantities sufficient for comprehensive studies.

According to available product information, recombinant YndD can be produced in either Escherichia coli or yeast expression systems . The recombinant protein is typically produced with a histidine (His) tag, which facilitates purification using metal affinity chromatography techniques . The His-tagged YndD protein can be provided in either liquid form or as a lyophilized powder, depending on the requirements for storage and experimental applications .

Functional Analysis and Potential Biological Roles

In the absence of direct experimental evidence for YndD function, insights may be drawn from studies of other membrane proteins in B. subtilis, particularly those involved in membrane protein biogenesis. Bacillus subtilis contains two Oxa1p homologs, SpoIIIJ and YqjG, which participate in membrane protein biogenesis . These proteins belong to a family found across all domains of life that facilitate the insertion of proteins into membranes.

Studies have demonstrated that SpoIIIJ and YqjG are involved in membrane protein insertion, specifically in the integration of subunits of the F1Fo ATP synthase complex into the membrane . When isolated from B. subtilis cells, these proteins were found associated with the entire F1Fo ATP synthase complex, suggesting involvement in membrane assembly processes . They facilitate membrane insertion of F1Fo ATP synthase subunit c from both E. coli and B. subtilis into inner membrane vesicles of E. coli .

While no direct evidence links YndD to SpoIIIJ and YqjG, its classification as a membrane protein suggests it may interact with the membrane protein biogenesis machinery. Whether YndD serves as a substrate for these insertases or participates in distinct membrane processes remains to be determined through targeted experimental approaches.

Applications in Biotechnology and Research Significance

Research on YndD and other uncharacterized membrane proteins in B. subtilis carries significant implications for both fundamental science and biotechnological applications. Understanding YndD's function could provide insights into basic cellular processes in bacteria, including membrane protein biogenesis, transport mechanisms, and cell signaling pathways.

B. subtilis serves as an important industrial organism with numerous biotechnological applications. For instance, B. subtilis ATCC 6051a has been engineered for the production of catalases, enzymes that decompose hydrogen peroxide to oxygen and hydrogen . This strain is notable for high-level secretion of heterologous peptides, although its application has historically been limited by insufficient transformation efficiency . Researchers successfully addressed this limitation by integrating D-xylose inducible comK into the genome, generating a mutant with 1,000-fold higher transformation efficiency than the parent strain .

Table 3: Potential Biotechnological Applications of YndD Research

Application AreaPotential Contribution of YndD Research
Protein secretion systemsImproved understanding of membrane processes affecting protein secretion
Strain engineeringPotential target for genetic modification to enhance transformation efficiency
Biocatalyst developmentInsights into membrane protein insertion and complex assembly
Antibiotic developmentPossible novel target if essential for bacterial survival
Synthetic biologyEngineering membrane components for customized cellular functions

If YndD is involved in membrane processes that affect protein secretion or transformation efficiency, it could represent a valuable target for genetic modification to enhance these properties in industrial strains. The availability of recombinant YndD with a His tag facilitates various research applications that could elucidate its function and potential biotechnological utility .

Future Research Directions and Methodological Approaches

The uncharacterized nature of YndD presents numerous opportunities for future research. Several key investigative approaches could significantly advance our understanding of this protein:

  1. High-Resolution Structural Determination: While computational models provide preliminary structural insights , experimental determination using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy would yield more definitive structural information. Structural data could reveal functional domains and potential interaction surfaces.

  2. Genetic and Functional Studies: Gene knockout or knockdown studies would help determine the effects of YndD deletion on B. subtilis growth, survival, and cellular processes. Complementation studies with related proteins like SpoIIIJ and YqjG could reveal functional relationships or redundancies.

  3. Expression and Localization Analysis: Studies examining when and where YndD is expressed in B. subtilis, along with its subcellular localization, could provide functional clues. Techniques such as quantitative PCR, reporter fusions, and immunofluorescence microscopy would be valuable in these investigations.

  4. Interaction Network Mapping: Identifying proteins that interact with YndD would provide insights into its functional context. Approaches such as affinity purification coupled with mass spectrometry, bacterial two-hybrid screens, or proximity labeling techniques could reveal interaction partners.

  5. Comparative Genomics and Evolutionary Analysis: Analyzing the yndD gene and its genomic context across different bacterial species might reveal conserved genetic neighborhoods that suggest functional relationships.

Table 4: Proposed Methodological Approaches for YndD Characterization

Research ObjectiveMethodologyExpected Outcomes
Structural characterizationX-ray crystallography, Cryo-EM, NMRHigh-resolution structure revealing functional domains
Functional determinationGene knockout, Phenotypic analysisUnderstanding of physiological role and essentiality
Localization patternsFluorescence microscopy, FractionationSubcellular distribution and membrane topology
Protein-protein interactionsCo-immunoprecipitation, CrosslinkingIdentification of interaction partners and complexes
Transcriptional regulationRNA-seq, Promoter analysisConditions affecting yndD expression

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. If you have specific format requirements, please indicate them in your order, and we will accommodate them.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
yndD; BSU17750; Uncharacterized membrane protein YndD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-520
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yndD
Target Protein Sequence
MMRWRNNQYKTQKQHKSDYSTAEKQDQDVLTGNIGYDLEHVKRKIGHNGDVHFRELEITQ LHVKAALIFVEGLSDQDLINKGLSVLVMNQPNQVSDEISQSGKGILTSKQIKNQIVSIGD VIDSEKISDIVLNVFMGSTALLIDGIPQAFLLGTVKKQNRSIEEPLSEALVRGPRTGFTE ELSTNTALLRQQGKNDQLTLQRFEVGTRLKKDLIIAYMNDIADPKVVEEVRKRVRGIEID HLPESGYVEQLIEDNYLSPFPQVQSTERPDRVISGLMEGRVAILLDGTPFALIVPVTFSM MLQSPEDYYERWFPSSLIRLLRFIAAMITLFAPALYISFISFHPGLIPTKLAISISGTRQ GVPFPSLIEALFMEVAIEILREAGLRLPKPIGPAIGIVGGLIIGEAAVQAGIVSPIMVIV VALTAISSFAIPHYSTGIALRMLRFGAMFCAAVFGLFGVIMYYLLLSSHVVKLKSFGVPY ASPAVPYHLKDWKDFVIRMPLLVMKRRPKMMNTDNTKRVK
Uniprot No.

Target Background

Database Links
Protein Families
GerABKA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis yndD and why is it classified as an uncharacterized membrane protein?

yndD is a membrane protein encoded by the yndD gene (locus name BSU17750) in the Bacillus subtilis genome (strain 168). It is classified as "uncharacterized" because its precise biological function, substrates, and role in cellular processes remain unknown. The protein belongs to a category of predicted membrane proteins identified through genomic analysis but whose functions have not been experimentally validated. Membrane proteins like yndD are particularly challenging to characterize due to their hydrophobic nature and the difficulties associated with their expression, purification, and structural analysis. Current research suggests yndD may be involved in membrane-associated processes, but specific pathways and interactions require further investigation.

How does yndD relate to other membrane proteins in Bacillus subtilis?

yndD belongs to a larger group of membrane proteins in Bacillus subtilis, some of which may interact with membrane protein biogenesis machinery such as SpoIIIJ (the primary YidC homolog in B. subtilis). Recent research has identified several membrane proteins whose insertion depends on SpoIIIJ, though yndD's specific relationship to this pathway requires further investigation . Like other uncharacterized membrane proteins (such as yvbJ), yndD may participate in transport processes, signaling, or membrane integrity maintenance. Comparative genomic analyses suggest yndD may be conserved among related Bacillus species, indicating potential evolutionary significance. Sequence homology studies can provide insights into possible functional relationships with characterized proteins in other bacterial species.

What expression systems are most suitable for producing recombinant Bacillus subtilis yndD?

For expressing recombinant yndD, researchers should consider the following expression systems:

  • IPTG-Inducible Systems: The pHT43 vector containing the IPTG-inducible promoter derived from the B. subtilis groE operon has demonstrated success for membrane protein expression. This system has produced yields of 15-20 mg of proteins per liter of bacterial culture .

  • Self-Inducing Systems: Recent advances include self-inducing expression systems that eliminate the need for manual induction. The P srfA promoter has shown promise for membrane protein expression with yields reaching up to 14.6% of recombinant protein when optimized .

  • Sugar-Inducible Promoters: Carbohydrate-inducible systems using sucrose, mannose, xylose, or maltose have been developed as cost-effective alternatives to IPTG-based systems. These promoters can be particularly useful for large-scale production .

  • Host Strain Selection: Modified strains with reduced protease activity, such as WB800N, are recommended for membrane protein expression to minimize degradation. These strains have shown success with proteins similar to yndD .

When expressing yndD, it may be beneficial to incorporate a suitable tag (determined during the production process) to facilitate detection and purification while minimizing interference with protein folding and function .

What methodological approaches can be used to study membrane insertion of yndD?

To study the membrane insertion of yndD, researchers can employ these methodologies:

  • MifM Translation Arrest Sequence: This approach, based on ribosome stalling, can monitor YidC-dependent membrane insertion. The system has successfully identified eight membrane proteins as SpoIIIJ substrates in B. subtilis and could be adapted to study yndD insertion .

  • Site-Directed Mutagenesis: Introducing mutations in the conserved arginine in the hydrophilic groove of SpoIIIJ/YidC can help determine if yndD insertion depends on this machinery. Different substrates show varying dependence on this residue .

  • Charge Distribution Analysis: Examining the importance of negatively charged residues in yndD can provide insights into its insertion mechanism. Unlike MifM (a known YidC substrate), other membrane proteins show variable dependence on charged residues .

  • Fluorescent Protein Fusions: Fusing yndD with fluorescent reporters can allow real-time visualization of membrane insertion and localization using confocal microscopy.

  • Protease Protection Assays: These assays can determine the topology of yndD in the membrane by identifying which regions are accessible to proteases.

What purification strategies are most effective for yndD?

Effective purification of membrane proteins like yndD requires specialized approaches:

  • Detergent Selection: Initial screening of multiple detergents (e.g., DDM, LDAO, or CHAPS) is crucial for solubilizing yndD while maintaining its native structure.

  • Affinity Chromatography: The storage buffer for recombinant yndD typically includes Tris-based buffer with 50% glycerol . This suggests that affinity purification followed by buffer optimization has been successful.

  • Size Exclusion Chromatography: This technique can separate properly folded yndD from aggregates and improve sample homogeneity.

  • Tag Cleavage: If the expression construct includes a cleavable tag, removing it after initial purification can reduce potential interference with structural studies.

  • Stability Optimization: The recommendation to avoid repeated freeze-thaw cycles and to store working aliquots at 4°C for up to one week indicates that stability optimization is critical for maintaining protein integrity .

  • Reconstitution into Lipid Nanoparticles: For functional studies, reconstituting purified yndD into lipid nanodiscs or liposomes can provide a more native-like membrane environment.

How might yndD interact with the YidC/SpoIIIJ membrane insertion pathway?

The YidC/SpoIIIJ pathway is crucial for membrane protein biogenesis in bacteria. Several lines of evidence suggest potential interactions between yndD and this pathway:

  • Substrate Recognition Patterns: SpoIIIJ (the primary YidC homolog in B. subtilis) recognizes specific features in membrane proteins. Analysis of yndD's sequence could reveal similar recognition motifs found in known YidC substrates .

  • Conserved Arginine Interaction: Research has shown that a conserved arginine in the hydrophilic groove of SpoIIIJ is crucial for the membrane insertion of many substrates. Testing the importance of this interaction for yndD insertion could provide insights into its biogenesis pathway .

  • Charge Distribution Analysis: Unlike MifM (a well-characterized YidC substrate), other membrane proteins show variable dependence on negatively charged residues for insertion. Analyzing the charged residues in yndD could help predict its interaction mode with SpoIIIJ .

  • Competition Assays: Examining whether yndD competes with known YidC substrates for insertion machinery could clarify its dependence on this pathway.

  • Conditional Depletion Studies: Using strains with controllable expression of SpoIIIJ/YidC to observe effects on yndD localization and function could demonstrate pathway dependence.

Understanding these interactions would contribute significantly to our knowledge of substrate-specific interactions in membrane protein biogenesis in Gram-positive bacteria.

What approaches can be used to determine the function of uncharacterized membrane proteins like yndD?

Determining the function of uncharacterized membrane proteins requires multi-faceted approaches:

  • Genetic Context Analysis: Examining the genomic neighborhood of yndD (BSU17750) may reveal functional relationships with adjacent genes.

  • Phenotypic Analysis of Deletion Mutants: Creating yndD knockout strains and characterizing resulting phenotypes under various conditions can provide functional insights.

  • Protein-Protein Interaction Studies: Techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking studies can identify interaction partners, potentially revealing the pathways in which yndD participates.

  • Comparative Genomics: Analyzing conservation patterns and co-evolution with other genes across different bacterial species can suggest functional relationships.

  • Transcriptomic and Proteomic Profiling: Examining expression patterns of yndD under different conditions and in response to various stressors can indicate functional roles.

  • Structural Studies: While challenging for membrane proteins, techniques such as cryo-electron microscopy could provide structural insights that inform function.

  • Substrate Transport Assays: If yndD functions as a transporter, in vitro reconstitution systems with potential substrates could identify transport activities.

  • Localization Studies: Determining the precise subcellular localization of yndD using fluorescent protein fusions or immunofluorescence microscopy can provide functional clues.

How does membrane protein biogenesis in Bacillus subtilis differ from other bacterial systems?

Membrane protein biogenesis in B. subtilis presents distinct characteristics compared to other bacterial systems:

  • Dual YidC Homologs: B. subtilis possesses two YidC homologs (SpoIIIJ and YidC2/YqjG), whereas most Gram-negative bacteria have only one YidC protein. SpoIIIJ serves as the primary insertase under vegetative growth conditions .

  • Secretion Capacity: B. subtilis has a remarkable capacity for protein secretion, with well-developed systems that can be leveraged for heterologous expression of membrane proteins. This makes it an ideal platform for the heterologous expression of bioactive substances .

  • Substrate Recognition: The substrate recognition mechanism in B. subtilis YidC appears to be substrate-specific, with variable importance of charged residues for different proteins. This differs from the more uniform substrate recognition patterns observed in some other bacteria .

  • GRAS Status: B. subtilis has Generally Recognized As Safe (GRAS) status, making it advantageous for producing proteins for various applications, including those with medical and industrial value .

  • Genomic Integration: B. subtilis has a remarkable innate ability to absorb and incorporate exogenous DNA into its genome, facilitating the stable expression of recombinant proteins .

  • Secretion Signal Peptides: B. subtilis employs specific signal peptides that direct proteins for secretion, which can be exploited in expression systems for membrane protein production and secretion .

Understanding these differences is crucial for designing effective experimental approaches for studying yndD and other membrane proteins in B. subtilis.

What are the critical factors affecting recombinant yndD expression and quality?

Several factors significantly impact the successful expression of recombinant yndD:

  • Promoter Selection: The choice between constitutive, inducible, or self-inducing promoters significantly affects expression levels. Recent advances include using double promoters and functional synthetics for enhanced expression .

  • Induction Parameters: For IPTG-inducible systems, the concentration of inducer and timing of induction are critical. For sugar-inducible systems, the choice between sucrose, mannose, xylose, or maltose can impact both cost and efficiency .

  • Host Strain Selection: Modified strains with reduced protease activity, such as WB800N, show improved yields for membrane proteins by reducing proteolytic degradation .

  • Growth Conditions: Temperature, media composition, and aeration rates all affect membrane protein expression. Lower temperatures (20-30°C) often improve folding of complex membrane proteins.

  • Storage Conditions: The recommended storage in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, with avoidance of repeated freeze-thaw cycles, indicates the importance of proper handling to maintain protein integrity .

  • Signal Peptide Engineering: For membrane proteins targeted to specific locations, the selection or engineering of appropriate signal peptides can dramatically improve targeting and insertion efficiency .

  • Carbon Source Management: In self-inducing systems, the presence of glucose can prevent induction through carbon catabolite repression, creating conditions for controlled self-induction that can increase yields nearly three-fold .

How can researchers troubleshoot common challenges in yndD research?

When working with challenging membrane proteins like yndD, researchers may encounter several issues:

  • Low Expression Yields:

    • Try different expression strains with reduced protease activity

    • Optimize induction parameters (concentration, timing, temperature)

    • Consider self-inducing systems that have shown up to 14.6% yields for recombinant proteins

    • Use dual promoter systems for enhanced expression

  • Protein Aggregation:

    • Lower expression temperature (20-25°C)

    • Co-express with chaperones

    • Optimize lysis and extraction conditions

    • Screen multiple detergents for solubilization

  • Degradation During Purification:

    • Add protease inhibitors

    • Reduce purification time

    • Maintain cold temperatures throughout

    • Consider using strains with reduced protease activity

  • Difficult Membrane Insertion:

    • If insertion depends on YidC/SpoIIIJ pathway, ensure this machinery is not saturated

    • Analyze charge distribution in transmembrane domains that may affect insertion

    • Consider co-expression with specific chaperones

  • Function Assessment Challenges:

    • Use systematic approaches combining genetic, biochemical, and structural methods

    • Employ controlled depletion of potential interacting partners

    • Develop selective assays based on predicted functions

What data management considerations are important for yndD research projects?

Effective research on uncharacterized membrane proteins requires careful data management:

  • Experimental Conditions Documentation:

    • Record detailed protocols including precise expression conditions

    • Document all buffer compositions and purification parameters

    • Maintain comprehensive records of construct designs and modifications

  • Structural Analysis Integration:

    • Combine data from multiple prediction tools when analyzing potential transmembrane domains

    • Integrate hydrophobicity analyses with charge distribution patterns

    • Archive raw data from structural studies for potential reanalysis

  • Comparative Analysis Framework:

    • Establish clear comparison criteria when evaluating yndD against other membrane proteins

    • Develop standardized assays to enable direct comparisons of different constructs

    • Maintain databases of sequence variants and their functional consequences

  • Functional Assay Standardization:

    • Define clear positive and negative controls for functional assays

    • Establish quantitative metrics for membrane insertion efficiency

    • Create reproducible protocols for activity measurements

  • Collaborative Data Sharing:

    • Use standardized nomenclature and annotation

    • Implement version control for construct designs and experimental protocols

    • Consider establishing shared repositories for unpublished observations

How might advanced genomic and proteomic approaches enhance our understanding of yndD?

Emerging technologies offer new opportunities for characterizing yndD:

  • CRISPR-Cas9 Applications: Genome-editing technologies can create precise mutations or regulatory changes to study yndD function in vivo. The CRISPR-Cas9 system has been successfully applied to B. subtilis and could be used to generate conditional knockouts or tagged variants of yndD .

  • Ribosome Profiling: This technique can identify translational pauses during yndD synthesis, potentially revealing critical points in its biogenesis pathway, similar to how the MifM translation arrest sequence has been used to study YidC-dependent insertion .

  • Cryo-Electron Microscopy: Advances in this field now enable structural determination of membrane proteins at near-atomic resolution, potentially revealing yndD's structure and mechanism.

  • Amber Suppression Systems: The development of efficient amber suppression systems in B. subtilis enables the incorporation of non-canonical amino acids (ncAAs) into proteins. This approach could be used to introduce bio-orthogonal groups into yndD for chemical decoration or site-specific crosslinking studies .

  • Quorum Sensing-Based Systems: Dynamic regulation methods using quorum sensing-related promoters have been developed that can self-monitor and induce expression without human supervision. These could be adapted for controlled expression of yndD in different physiological contexts .

  • Systematic Substrate Screening: Approaches similar to those used to identify YidC substrates could be applied to discover potential substrates or interaction partners of yndD .

What significance might yndD research have for understanding broader biological processes?

Research on yndD has implications beyond its specific function:

  • Membrane Protein Biogenesis Insights: Studying how yndD is inserted into membranes could reveal general principles about membrane protein biogenesis pathways in Gram-positive bacteria, where fewer YidC substrates have been identified compared to Gram-negative bacteria .

  • Biotechnological Applications: Understanding yndD function could contribute to the development of B. subtilis as a cell factory for the production of recombinant proteins, especially those associated with foods and food processing .

  • Antimicrobial Target Development: If yndD proves essential under specific growth conditions, it could represent a potential target for antimicrobial compounds specific to Bacillus species.

  • Synthetic Biology Tools: Characterization of yndD could provide new components for synthetic biology applications in B. subtilis, contributing to the technological arsenal available for this expression platform .

  • Evolutionary Insights: Comparative analysis of yndD across bacterial species could reveal evolutionary patterns in membrane protein function and regulatory networks.

  • Methodological Advancements: The challenges of working with yndD drive innovation in expression, purification, and characterization techniques that benefit membrane protein research broadly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.