Recombinant Bacillus subtilis Uncharacterized membrane protein yndG (yndG)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its use.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its use.
Synonyms
yndG; BSU17780; Uncharacterized membrane protein YndG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yndG
Target Protein Sequence
MRQKPIYVEIEMKSDLDTLWEYTQNPSLHKEWDLRFSNITYLNSQPCEKQKFLYETRVGF
GLKVSGTGETVGVFNKCSSERSSSLAFGSDHPLSLIRHGSGYWKYIQRENGKMTFLTQYQ
YKTAYGLLGRWIDRLLFRPLLGWATAWSFDALRLWVEQNKHPKRFIRSAIIYVFMCLFFS
LFWFYQGFAGVKTSILTGTAEIGLAILWLLPLKRKWIIHGVQACIFAGFACLGSEIFMWV
LLSVFSAASGALSLQLPSARRTKRKRKK
Uniprot No.
Target Background
Database Links
KEGG: bsu:BSU17780
STRING: 224308.Bsubs1_010100009796
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
