Recombinant Bacillus subtilis Uncharacterized membrane protein yndK (yndK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer needs.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yndK; BSU17810; Uncharacterized membrane protein YndK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yndK
Target Protein Sequence
MNCFKILHRIKTGKEGFMVFYISLFLILWLAAGFAVGMKQVYVDQLFDKAVIERLEKEAN DHGHADRMIKQRVLYIAAVTVSGFISVYYEMKTIPQRRNIRKIEKNIMKLNQAKKRRMKR K
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the basic molecular properties of yndK?

YndK is an uncharacterized membrane protein from Bacillus subtilis strain 168 with the following key properties:

PropertyValueSource
Length121 amino acids
Molecular Mass14.326 kDa
Gene LocusBSU17810
UniProt AccessionO31814
Amino Acid SequenceMNCFKILHRIKTGKEGFMVFYISLFLILWLAAGFAVGMKQVYVDQLFDKAVIERLEKEANDHGHADRMIKQRVLYIAAVTVSGFISVYYEMKTIPQRRNIRKIEKNIMKLNQAKKRRMKRK

The protein contains hydrophobic regions consistent with transmembrane domains, as evidenced by the amino acid composition with stretches of hydrophobic residues (e.g., FMVFYISLFLILWLAAG), indicating integration into the cell membrane . Analysis of the sequence suggests yndK likely adopts an alpha-helical conformation within the membrane, consistent with approximately 25% of the proteome in all organisms being alpha-helical integral membrane proteins .

What experimental approaches can determine the membrane topology of yndK?

To characterize the membrane topology of yndK, researchers should employ a multi-method approach:

  • Computational prediction: Use algorithms like TMHMM, Phobius, or TOPCONS to predict transmembrane domains and orientation.

  • Fusion protein analysis: Create systematic fusions with reporter tags (e.g., PhoA, GFP) at various positions to experimentally map which regions are cytoplasmic or extracellular.

  • Single-molecule force spectroscopy (SMFS): This technique can provide direct structural information on membrane proteins in their native environment . The methodology involves:

    • Extract membrane fragments suitable for SMFS to obtain force-distance curves

    • Apply unsupervised clustering to detect similar unfolding patterns

    • Implement Bayesian meta-analysis using mass spectrometry and protein structure database information

    • Confirm findings with specifically engineered constructs

  • Protease accessibility: Limited proteolysis combined with mass spectrometry to identify exposed regions.

The SMFS approach is particularly valuable as it allows gathering structural properties at room temperature in the native cell membrane at a single-cell level, providing information that cannot be captured by other methods .

What expression systems are optimal for recombinant yndK production?

Bacillus subtilis is the preferred expression system for producing its native membrane protein yndK due to several advantages:

  • GRAS status: B. subtilis is generally recognized as safe, making it ideal for laboratory work .

  • Natural competence: B. subtilis possesses a remarkable innate ability to absorb and incorporate exogenous DNA into its genome, facilitating genetic manipulation .

  • Secretion capacity: B. subtilis has efficient protein secretion pathways that can be leveraged for membrane protein expression .

  • Available genetic tools: There are multiple established promoter systems, plasmids, and induction strategies optimized for B. subtilis .

For optimal expression, consider these specific strategies:

  • Use of inducible promoters such as the xylose-inducible system (PxylA) for controlled expression

  • Application of self-inducible expression systems that are increasingly in demand for their practicality

  • Incorporation of appropriate signal peptides if secretion is desired

  • Implementation of genetic engineering strategies including different plasmids and promoter engineering

What methodological approach should be used to generate recombinant B. subtilis strains expressing yndK?

A methodical approach for generating B. subtilis strains expressing recombinant yndK involves integration into the chromosome rather than using plasmid-based systems. The BlaI cassette method is particularly effective:

  • Design an integration cassette: Create a construct containing:

    • The yndK gene with desired modifications (e.g., tags, mutations)

    • A selection marker (e.g., spectinomycin resistance)

    • The BlaI repressor gene

    • Short direct repeat sequences flanking the cassette

  • Transformation: Transform the cassette into a conditional auxotroph B. subtilis strain (such as BS1541) .

  • Selection: Select transformants based on spectinomycin resistance, confirming integration by PCR.

  • Marker eviction: Remove the selection marker through single crossover between direct repeat sequences, resulting in marker-free recombinant strains .

  • Verification: Confirm the final construct by PCR amplification and sequencing.

This method allows for successive modifications of the B. subtilis chromosome without accumulating selection markers, enabling multiple rounds of genetic engineering .

How reliable is the predicted structure of yndK and what experimental approaches can validate it?

The AlphaFold-predicted structure of yndK (AF_AFO31814F1) has a global pLDDT score of 66.48, which falls into the "Low" confidence range (50 < pLDDT ≤ 70) . This indicates moderate uncertainty in the predicted structure, particularly in the membrane-spanning regions which are challenging for computational prediction.

To experimentally validate and refine this structural model:

  • X-ray crystallography: Requires high-purity protein crystals, which is challenging for membrane proteins but provides high-resolution structures.

  • Cryo-electron microscopy: Increasingly powerful for membrane proteins, allowing visualization in near-native states without crystallization.

  • NMR spectroscopy: Particularly useful for dynamic regions and can provide information about protein movement in the membrane.

  • Cross-linking mass spectrometry: Identifies spatial relationships between amino acids to validate predicted proximity in the model.

  • Limited proteolysis: Identifies exposed regions that should correspond to loops in the structural model.

  • SMFS (Single-Molecule Force Spectroscopy): As described in search result , this technique can provide direct structural information on membrane proteins in their native environment, which can be compared with the computational model.

The combination of these approaches will provide complementary data to refine the structural model of yndK with greater confidence.

What techniques can analyze yndK membrane insertion and topology in a native-like environment?

Analysis of yndK membrane insertion requires techniques that preserve the native folding environment:

  • Nanodiscs or liposome reconstitution: Incorporate purified yndK into synthetic lipid bilayers that mimic the bacterial membrane composition, then analyze using:

    • Fluorescence spectroscopy with environment-sensitive probes

    • Electron paramagnetic resonance (EPR) spectroscopy

    • Hydrogen-deuterium exchange mass spectrometry

  • In vivo site-specific labeling: Introduce cysteine residues at strategic positions for labeling with membrane-impermeable probes.

  • Unfolding and identification methodology: As described in search result , this approach allows:

    • Extraction of membrane fragments suitable for analysis

    • Application of force to unfold the protein

    • Recording of force-distance curves

    • Analysis using unsupervised clustering

    • Identification through Bayesian meta-analysis

  • Co-translational insertion analysis: Study the insertion mechanism based on the unifying model for membrane protein biogenesis, which posits that:

    • Oxa1 family proteins insert transmembrane domains flanked by short translocated segments

    • SecY is required for insertion of transmembrane domains flanked by long translocated segments

    • Membrane-proximal protein synthesis facilitates co-translational insertion by successively inserting TMD pairs as they emerge from the ribosome

Understanding the insertion mechanism will provide insights into both the structure and function of yndK in its native membrane environment.

What approaches can determine the function of uncharacterized membrane proteins like yndK?

Determining the function of yndK requires a multi-faceted approach:

  • Comparative genomics:

    • Analyze gene neighborhood to identify functionally related genes

    • Examine co-occurrence patterns across bacterial species

    • Identify conserved domains that might suggest function

  • Gene knockout and phenotypic analysis:

    • Generate yndK deletion strains using the BlaI cassette method

    • Conduct comprehensive phenotypic screening under various conditions

    • Compare growth rates, morphology, stress responses, and metabolic profiles

  • Transcriptomic analysis:

    • Perform RNA-seq comparing wild-type and yndK knockout strains

    • Identify differentially expressed genes that may be functionally related

    • Analyze expression patterns under different environmental conditions

  • Protein-protein interaction studies:

    • Conduct pull-down assays with tagged yndK

    • Perform bacterial two-hybrid screening

    • Use crosslinking followed by mass spectrometry to identify interaction partners

    • Apply proximity labeling techniques (e.g., BioID) to map the protein neighborhood

  • Localization studies:

    • Visualize subcellular localization using fluorescently tagged yndK

    • Examine temporal changes in localization during cell cycle or stress responses

Each approach provides complementary information that, when integrated, can suggest potential functional roles for this uncharacterized membrane protein.

How can researchers design experiments to identify potential interaction partners of yndK?

To identify interaction partners of yndK, a systematic experimental design should include:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express yndK with an affinity tag (His, FLAG, or TAP tag)

    • Carefully solubilize the membrane using mild detergents to preserve protein-protein interactions

    • Perform pull-down assays followed by mass spectrometry analysis

    • Include appropriate controls (e.g., tag-only, irrelevant membrane protein) to filter non-specific interactions

    • Validate findings with reciprocal pull-downs

  • Bacterial two-hybrid screening:

    • Create a fusion of yndK with one domain of a split reporter protein

    • Screen against a library of B. subtilis proteins fused to the complementary domain

    • Validate positive interactions with alternative methods

  • Crosslinking strategy:

    • Incorporate photo-activatable or chemical crosslinkers into living cells

    • Induce crosslinking to capture transient interactions

    • Identify crosslinked partners by mass spectrometry

    • Verify with targeted approaches like co-immunoprecipitation

  • Proximity-based labeling:

    • Fuse yndK to a promiscuous biotin ligase (BioID) or peroxidase (APEX)

    • Allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • Create a spatial map of the yndK neighborhood

  • Genetic interaction mapping:

    • Generate double mutants combining yndK deletion with other gene knockouts

    • Identify synthetic lethal or synthetic rescue phenotypes

    • Map genetic interaction networks to infer functional relationships

Present interaction data in a network visualization with confidence scores and validation status for each interaction.

How might yndK be involved in membrane protein biogenesis pathways?

YndK could potentially play a role in membrane protein biogenesis pathways based on several characteristics:

  • Potential involvement in insertion mechanisms: Given the unifying model for membrane protein biogenesis described in search result , yndK could be involved in:

    • Facilitating the triage of nascent membrane proteins between Oxa1 and SecY family members

    • Acting as a ribosome receptor that allows synthesis close to the membrane

    • Assisting with co-translational insertion of multi-TMD proteins

  • Role in membrane protein quality control: As an uncharacterized membrane protein, yndK might function in:

    • Recognition of misfolded membrane proteins

    • Facilitation of proper folding or degradation of membrane proteins

    • Maintenance of membrane protein homeostasis

  • Experimental approaches to investigate this hypothesis:

    • Generate conditional depletion strains of yndK and monitor effects on global membrane proteome

    • Perform ribosome profiling to assess impact on translation of membrane proteins

    • Use site-specific crosslinking to capture transient interactions during membrane protein synthesis

    • Analyze the impact of yndK deletion on membrane protein insertion using reporter constructs

The low confidence score (pLDDT of 66.48) of the predicted structure suggests regions of flexibility that could be involved in accommodating diverse client proteins during membrane insertion processes.

What CRISPR-based approaches can be used to study yndK function in its native context?

CRISPR technology offers powerful approaches for studying yndK in its native genomic context:

  • CRISPR interference (CRISPRi) for tunable gene repression:

    • Design sgRNAs targeting the yndK promoter or coding sequence

    • Express catalytically dead Cas9 (dCas9) to block transcription without DNA cleavage

    • Create an inducible system for temporal control of repression

    • Monitor phenotypic changes under various conditions

  • CRISPR activation (CRISPRa) for upregulation:

    • Fuse transcriptional activators to dCas9

    • Target the yndK promoter region to enhance expression

    • Examine effects of yndK overexpression on cell physiology

  • Base editing for targeted mutagenesis:

    • Use CRISPR base editors to introduce specific mutations without double-strand breaks

    • Create systematic variants to map structure-function relationships

    • Target conserved residues identified through comparative analysis

  • CRISPR-mediated tagging for localization and interaction studies:

    • Insert fluorescent protein or affinity tags at the endogenous locus

    • Maintain native regulation while enabling visualization or purification

    • Study dynamics and interactions in live cells

  • CRISPR scanning mutagenesis:

    • Systematically target different regions of yndK using multiple sgRNAs

    • Generate a library of mutations through error-prone repair

    • Screen for phenotypes to identify functional domains

  • CRISPR-X for in situ directed evolution:

    • Target mutagenesis machinery to the yndK locus

    • Generate diversity within a defined region

    • Select for enhanced or novel functions

When implementing these approaches, researchers should carefully consider the potential for off-target effects and validate findings using complementary methods.

How does yndK compare structurally and functionally to other uncharacterized membrane proteins in B. subtilis?

A comparative analysis between yndK and other uncharacterized membrane proteins in B. subtilis reveals important distinctions and similarities:

ProteinLength (aa)MW (kDa)TM DomainsStructural ConfidenceKnown MotifsGene Neighborhood
YndK12114.3261-2Low (pLDDT: 66.48)None identifiedNear yndJ
YdaK283~313-4Not reportedNone identifiedDifferent locus

Despite both being uncharacterized membrane proteins in B. subtilis, yndK and ydaK differ significantly in size and likely in function, as evidenced by:

  • Size disparity: YndK is considerably smaller (121 aa vs. 283 aa), suggesting potentially different functional roles .

  • Sequence analysis: No significant sequence homology between these proteins indicates they likely evolved independently.

  • Experimental approaches for functional comparison:

    • Simultaneous knockout experiments to identify differential or overlapping phenotypes

    • Transcriptomic analysis of both knockout strains to identify distinctive regulatory networks

    • Complementation assays to test functional redundancy

    • Comparative interaction network mapping

This comparative approach can extend to other uncharacterized membrane proteins, potentially revealing functional clusters and evolutionary relationships that may guide future research directions.

What are the emerging technologies for studying membrane proteins that could advance yndK research?

Several cutting-edge technologies are poised to revolutionize research on uncharacterized membrane proteins like yndK:

  • Cryo-electron tomography (cryo-ET):

    • Visualizes membrane proteins in their native cellular environment

    • Achieves near-atomic resolution without protein extraction or crystallization

    • Can reveal yndK location, organization, and native interactions

  • AlphaFold and RoseTTAFold integration with experimental data:

    • Combines AI structure prediction with sparse experimental constraints

    • Particularly valuable for membrane proteins like yndK where the current predicted structure has only moderate confidence (pLDDT: 66.48)

    • Enables structure-based functional hypothesis generation

  • Single-cell proteomics:

    • Analyzes membrane protein expression at single-cell resolution

    • Reveals cell-to-cell variability in yndK expression and localization

    • Can identify subpopulations with distinct yndK functions

  • In-cell NMR spectroscopy:

    • Studies membrane protein structure and dynamics in living cells

    • Provides atomic-level insights into yndK behavior in its native environment

    • Detects conformational changes upon interaction with other cellular components

  • SMFS (Single-Molecule Force Spectroscopy):

    • Extracts membrane fragments suitable for analysis

    • Obtains force-distance curves that reveal structural properties

    • Allows identification of membrane proteins at the single-cell level

    • Could potentially map the structural topology of yndK in its native membrane environment

  • Spatial transcriptomics and proteomics:

    • Maps the spatial distribution of yndK mRNA and protein

    • Correlates yndK localization with cellular architecture

    • Identifies spatial co-expression patterns suggesting functional relationships

Integrating these technologies will provide unprecedented insights into the structure, dynamics, and function of yndK, potentially revealing its role in B. subtilis membrane biology and opening new avenues for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.