Recombinant Bacillus subtilis Uncharacterized membrane protein yndM (yndM)

Shipped with Ice Packs
In Stock

Description

Introduction to yndM Protein

The yndM protein is an integral membrane protein encoded by the yndM gene in Bacillus subtilis. Specifically identified in Bacillus subtilis strain 168, this protein is cataloged in the UniProt database with the identifier O31816 . The protein is referred to as "uncharacterized," indicating that its precise biological function remains to be fully elucidated. The gene is also known by the systematic locus name BSU17830, and the protein is formally designated as an uncharacterized membrane protein . As a membrane protein, yndM is expected to be integrated into the bacterial cell membrane, likely playing a role in membrane-associated processes, though the specific function remains to be determined through further research.

The protein consists of 179 amino acids and has characteristics typical of membrane proteins, including hydrophobic regions that likely facilitate its integration into the lipid bilayer. While the function of yndM remains unclear, its conservation in Bacillus subtilis suggests it may have significance for bacterial physiology or membrane integrity. The protein has been successfully expressed as a recombinant protein with various tags, most commonly with a histidine tag (His-tag) to facilitate purification and subsequent study .

Recombinant Expression Systems

The yndM protein has been successfully expressed as a recombinant protein in heterologous expression systems. According to the available information, the primary expression system used for production of recombinant yndM protein is Escherichia coli, although expression in yeast systems has also been reported . The full-length protein (amino acids 1-179) has been expressed with an N-terminal histidine tag to facilitate purification and detection .

Purification Techniques

Purification of the recombinant yndM protein typically employs affinity chromatography, taking advantage of the N-terminal histidine tag. This approach allows for selective binding of the His-tagged protein to metal affinity resins, followed by elution with imidazole or similar competitive agents . Following purification, the protein is typically available in either liquid form or as a lyophilized powder, depending on the intended application and storage requirements .

The purification process results in a product with high purity, typically greater than 90% as determined by SDS-PAGE analysis . This level of purity is sufficient for most research applications, including biochemical characterization, antibody production, and potentially structural studies.

Current Research and Potential Functions

Despite being classified as "uncharacterized," the yndM protein may share functional characteristics with other membrane proteins in Bacillus subtilis. While the search results do not provide direct information about the function of yndM, they do offer some context about membrane proteins in B. subtilis that may be relevant.

In B. subtilis, membrane proteins play crucial roles in various cellular processes, including cell wall synthesis, stress response, and membrane integrity maintenance. For instance, the YidC family of membrane protein insertases, such as YidC1 (SpoIIIJ), are involved in the insertion of proteins into the membrane and are essential for viability . While there is no direct evidence linking yndM to these functions, its nature as a membrane protein suggests it may participate in membrane-associated processes.

Additionally, the general stress response in B. subtilis involves numerous genes regulated by sigma factors such as σB and σW, which control the expression of proteins involved in responding to various environmental stresses . The potential involvement of yndM in these stress response pathways remains an open question for investigation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yndM; BSU17830; Uncharacterized membrane protein YndM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yndM
Target Protein Sequence
MTIMNGFELHYLSFVYAQEFSSKNNNLGGQMKHIIALASKIAFTLALLYVILDRVYHASF LSVMFIALFLGFVSYLSGDMLVLPRTNNITASLADFGLSFVILWVFVLTQTRNDFSPFGA ALLSAACLTVFEYFFHRYLLKNVLDENFRNELSARDNTLQYQTEAADELFPETKEKHKE
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for recombinant yndM production?

For recombinant yndM production, E. coli has been successfully employed as an expression system. Current data indicates that full-length yndM (1-179aa) can be effectively expressed in E. coli with an N-terminal His-tag . When designing expression experiments, researchers should consider:

  • Expression vector selection: Vectors with strong, inducible promoters are recommended for membrane protein expression.

  • Strain optimization: E. coli strains specifically designed for membrane protein expression (such as C41/C43) may yield better results.

  • Induction conditions: Lower temperature induction (16-25°C) often improves folding of membrane proteins.

  • Solubilization strategy: Detergent screening is crucial for membrane protein solubilization.

When selecting an experimental design for expression studies, randomized block designs or factorial experiments are appropriate to systematically test different expression conditions . This approach allows researchers to evaluate the effects of multiple factors (temperature, inducer concentration, time) simultaneously while controlling for batch-to-batch variation .

What purification strategies are most effective for isolating recombinant yndM?

Purification of recombinant yndM typically leverages the His-tag fusion present in commercially available constructs. An effective purification strategy involves:

  • Cell lysis optimization: Membrane proteins require careful extraction from cellular membranes using detergents.

  • Immobilized Metal Affinity Chromatography (IMAC): The His-tag allows for purification using Ni-NTA or similar resin.

  • Detergent screening: Multiple detergents should be tested to identify optimal conditions for maintaining protein stability.

  • Size exclusion chromatography: As a polishing step to enhance purity and remove aggregates.

Purification StepRecommended ConditionsKey Considerations
Membrane isolationDifferential centrifugationGentle lysis to preserve membrane integrity
Solubilization1-2% detergent (e.g., DDM, LDAO)Screen multiple detergents and concentrations
IMACNi-NTA resin, imidazole gradientInclude detergent in all buffers
Size exclusionSuperdex 200 or similarAssess oligomeric state

For experimental design of purification optimization, a factorial approach testing multiple detergents, pH conditions, and salt concentrations would be appropriate . This allows systematic evaluation of which factors most influence purification yield and protein stability.

What are the recommended storage and handling practices for yndM preparations?

Based on available information for recombinant yndM, the following storage and handling practices are recommended:

  • Storage temperature: Store at -20°C or -80°C, with the latter preferred for long-term storage .

  • Aliquoting: Divide the purified protein into single-use aliquots to avoid freeze-thaw cycles .

  • Buffer composition: Tris/PBS-based buffer with 6% trehalose (pH 8.0) has been shown to maintain stability .

  • Reconstitution: Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Cryoprotectant: Addition of 5-50% glycerol (final concentration) is recommended, with 50% being optimal for long-term storage .

Researchers should note that repeated freeze-thaw cycles significantly impair membrane protein integrity, and working aliquots should be maintained at 4°C for no more than one week .

What experimental designs are appropriate for functional characterization of yndM?

For functional characterization of an uncharacterized membrane protein like yndM, several experimental design approaches are recommended:

When designing experiments, researchers should ensure high internal validity through careful control of extraneous variables while also considering external validity to ensure findings can be generalized beyond specific laboratory conditions .

How can researchers address challenges specific to membrane protein studies when working with yndM?

Membrane proteins like yndM present several unique challenges that require specialized approaches:

  • Protein stability: Maintaining the native conformation of membrane proteins outside their lipid environment is challenging. Researchers should:

    • Screen multiple detergents and lipid-like molecules (e.g., nanodiscs, amphipols)

    • Consider reconstitution into liposomes for functional studies

    • Optimize buffer conditions (pH, ionic strength, additives)

  • Structural characterization: Traditional structural biology techniques require adaptation for membrane proteins.

    • Crystallization trials should include detergent screening and lipidic cubic phase approaches

    • Cryo-EM may offer advantages for membrane proteins resistant to crystallization

    • NMR studies may require specific isotopic labeling strategies

  • Functional reconstitution: For activity assays, researchers should consider:

    • Proteoliposome reconstitution to assess transport or channel activity

    • Solid-supported membrane electrophysiology

    • Fluorescence-based assays to monitor conformational changes

What bioinformatic approaches can predict functional aspects of yndM?

In the absence of complete experimental characterization, bioinformatic approaches can provide valuable insights into potential yndM functions:

  • Sequence homology analysis:

    • BLAST searches against characterized proteins

    • Identification of conserved domains and motifs

    • Phylogenetic analysis to identify evolutionary relationships

  • Structural prediction:

    • Transmembrane topology prediction using tools like TMHMM, Phobius

    • Ab initio and homology-based structural modeling

    • Molecular dynamics simulations to predict dynamic behavior

  • Functional prediction:

    • Gene neighborhood analysis

    • Co-expression network analysis

    • Metabolic pathway integration

When evaluating bioinformatic predictions, researchers should design validation experiments that directly test the hypothesized functions. This exemplifies the relationship between in silico analysis and laboratory experimentation that characterizes modern protein research .

How can contradictory data about yndM function be reconciled in research?

When faced with contradictory data regarding yndM function, researchers should implement a systematic approach to reconciliation:

  • Methodological evaluation: Critically assess experimental designs for potential sources of bias or error . This includes:

    • Evaluating internal validity of conflicting studies

    • Assessing measurement reliability and validity

    • Examining potential confounding variables

  • Replication studies: Design experiments specifically to replicate contradictory findings under controlled conditions .

    • Use larger sample sizes to increase statistical power

    • Implement blinding where appropriate

    • Pre-register protocols to avoid confirmation bias

  • Integrative analysis: Consider that seemingly contradictory findings might reflect:

    • Context-dependent protein functions

    • Different experimental conditions affecting protein behavior

    • Multifunctional nature of the protein

For experimental design, researchers should consider factorial designs that systematically vary the conditions under which contradictory results were obtained . This approach allows direct comparison of the effects of different methodological choices on experimental outcomes.

What analytical techniques provide the most insight into yndM structure-function relationships?

For comprehensive structure-function analysis of yndM, researchers should consider multiple complementary analytical approaches:

For experimental design considerations, researchers should implement control conditions that allow clear attribution of observed effects to specific structural features . Within-subject designs may be appropriate for comparing wild-type and mutant protein variants, while factorial designs can efficiently evaluate the effects of multiple mutations across different functional assays .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.