Recombinant Bacillus subtilis Uncharacterized membrane protein yngA (yngA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. To prioritize a specific tag, please inform us during your order; we will endeavor to accommodate your request.
Synonyms
yngA; BSU18170; Uncharacterized membrane protein YngA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yngA
Target Protein Sequence
MTATRIFYEGRFVTLKEKIKTLGRFCTVGVGNTLIDFGVFFLLTACHVSYLPAQICSYTA GIVNSYVWNRNWTFCVKRKADGKEIVRFLMINIAASGITFLLLYLFQNCGCSLLVSKLAA TIGGMMMNFIGNRIWVFGDSLKNIQDQE
Uniprot No.

Target Background

Database Links
Protein Families
GtrA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is currently known about the YngA membrane protein in Bacillus subtilis?

YngA (UniProt ID: O31821) is an uncharacterized membrane protein in Bacillus subtilis strain 168. It is also referred to as hypothetical protein BSU18170 . Despite B. subtilis being one of the most extensively studied model organisms, YngA belongs to approximately 20% of proteins whose functions remain unidentified . Current genomic analysis suggests YngA is part of the yngABC operon, which may be co-regulated with other membrane-associated proteins . Proteomic analyses have detected YngA expression under specific conditions, particularly during anaerobic growth, suggesting potential oxygen-dependent regulation similar to its operon partner YngB .

What methodologies are recommended for recombinant expression of YngA?

For recombinant expression of YngA, several approaches have been validated:

  • E. coli expression systems: Use of T7 promoter-based vectors with His-tags for affinity purification, achieving purity >85% as determined by SDS-PAGE .

  • Cell-free expression systems: These have been employed successfully for membrane proteins like YngA to avoid toxicity issues associated with membrane protein overexpression .

  • B. subtilis expression systems: For native-like expression, the method described by Fabret et al. can be adapted, using integration cassettes containing antibiotic resistance genes combined with conditional auxotrophy-based selection .

The recommended buffer for storage is PBS, with storage at +4°C for short-term use and -20°C to -80°C for long-term storage .

How can I optimize membrane protein extraction for YngA studies?

Membrane protein extraction for YngA requires specialized techniques to preserve structural integrity:

Table 1: Comparison of Extraction Methods for YngA Membrane Protein

MethodAdvantageDisadvantageYieldPurity
Ionic liquid-assisted (i-soln)Works with sub-microgram samples; preserves structureRequires specialized reagentsHigh>85%
SDS solubilizationGood for denaturing conditionsDisrupts native conformationMedium70-80%
Detergent-based (DDM/CHAPS)Maintains some native interactionsVariable efficiencyMedium75-85%
pTRUST techniqueHighest sensitivity; allows proteomics with limited materialComplex methodologyHigh>90%

The ionic liquid-assisted technique (i-soln) has shown superior results for extracting membrane proteins from B. subtilis, allowing analysis of samples as small as 0.4-0.5 μg protein . For YngA specifically, this approach preserves structural elements that might be critical for functional characterization.

What computational approaches can predict the structure and function of YngA?

For uncharacterized membrane proteins like YngA, a multi-tiered computational approach is recommended:

  • Transmembrane topology prediction: Tools like TMHMM, TOPCONS, and the UniTmp database should be used to predict transmembrane segments . For YngA, these tools predict multiple transmembrane domains.

  • Structural homology modeling: While no direct structural data exists for YngA, structural prediction using AlphaFold2 or RoseTTAFold can generate preliminary models.

  • Functional prediction through genomic context: Analysis of the yngABC operon suggests functional relationships with YngB, which has been characterized as involved in cell wall teichoic acid glucosylation under anaerobic conditions .

  • Deep learning approaches: Recent capsule neural network models (CapNet, OCNN, and ICNN) have shown success in predicting membrane protein types with accuracies of >90% .

The combination of these approaches can provide testable hypotheses about YngA function for experimental validation.

How does the genomic context of yngA inform potential functional roles?

Analysis of the genomic context provides significant insights into YngA's potential function:

The yngA gene is part of the yngABC operon in B. subtilis. YngB has been characterized as a UTP-glucose-1-phosphate uridylyltransferase involved in UDP-glucose production during anaerobic growth . This genomic association suggests YngA may:

  • Function in related metabolic pathways involving UDP-glucose utilization

  • Contribute to cell wall modification under oxygen-limited conditions

  • Potentially serve as a membrane transporter for glycosylated compounds

The operon structure and associated transcription factors suggest that YngA expression is likely regulated by oxygen availability, similar to YngB, which is expressed from its native promoter under anaerobic conditions . This genomic context provides direction for experimental conditions that might reveal YngA function, particularly focusing on anaerobic growth.

What experimental approaches are most effective for determining the function of uncharacterized membrane proteins like YngA?

For functional characterization of uncharacterized membrane proteins like YngA, a systematic approach is recommended:

  • Gene deletion studies: Creating ΔyngA mutants and examining phenotypes under various conditions, particularly anaerobic growth, focusing on cell wall integrity, morphology, and stress responses .

  • Protein-protein interaction studies: Chemical cross-linking followed by mass spectrometry to identify interaction partners. Based on methodologies used for other B. subtilis membrane proteins, this approach has successfully identified functional relationships .

  • Localization studies: Fluorescent tagging approaches using GFP fusions to determine subcellular localization patterns during different growth phases and conditions .

  • Comparative genomics: Examining yngA conservation across Bacillus species can reveal evolutionary importance. For instance, studies of B. subtilis derived from yaks showed unique adaptations in membrane proteins related to extreme environment adaptation .

  • Transcriptional analysis: RNA-seq under different conditions to identify co-regulated genes, providing functional insights through guilt by association.

How can I design experiments to distinguish YngA's role from other members of the yngABC operon?

Distinguishing YngA's specific role requires sophisticated experimental design:

  • Individual and combinatorial gene deletions: Create ΔyngA, ΔyngB, ΔyngC single mutants and all possible combinations of double and triple mutants. Compare phenotypes under aerobic and anaerobic conditions.

  • Complementation assays: Express each gene individually in the triple deletion background to identify which phenotypes are rescued by which genes.

  • Domain swapping: Create chimeric proteins between YngA and characterized membrane proteins to identify functional domains.

  • Conditional expression systems: Use the Bacillus-specific inducible systems like P hyperspank promoter to control expression levels of each operon member independently .

  • Metabolomic profiling: Compare metabolite profiles between wild-type and mutant strains under anaerobic conditions, focusing on UDP-glucose-related pathways known to involve YngB.

This systematic approach can delineate YngA's function while accounting for potential functional overlap within the operon.

What are the methodological challenges in studying YngA's potential role in anaerobic conditions?

Studying membrane proteins under anaerobic conditions presents specific challenges:

  • Maintaining strict anaerobic conditions: Use specialized equipment like anaerobic chambers with constant monitoring of oxygen levels using resazurin indicators.

  • Protein stability concerns: YngA may have different stability profiles under aerobic versus anaerobic conditions. Optimize extraction buffers with appropriate reducing agents (TCEP preferred over DTT) to maintain native conformation .

  • Altered membrane composition: B. subtilis modifies its membrane composition under anaerobic conditions, potentially affecting YngA insertion and function. Consider using native membrane mimetics for in vitro studies.

  • Metabolic shifts: Anaerobic growth causes significant metabolic reprogramming in B. subtilis. Design experiments to account for these global changes when interpreting YngA-specific effects.

  • Technical limitations in imaging: Live-cell imaging under anaerobic conditions requires specialized microscopy setups. Consider fixed-cell approaches with rapid sampling to minimize oxygen exposure.

How can high-throughput approaches be applied to characterize YngA function?

High-throughput approaches for YngA characterization include:

  • Phenotype microarrays: Test ΔyngA mutants against hundreds of growth conditions simultaneously to identify specific sensitivities, particularly focusing on cell wall stressors and anaerobic conditions.

  • Synthetic genetic arrays: Systematic creation of double mutants combining ΔyngA with other B. subtilis knockouts to identify genetic interactions through growth phenotypes.

  • Proteomics approaches: Quantitative proteomics comparing wild-type and ΔyngA strains can reveal compensatory protein expression changes indicating functional pathways. The pTRUST methodology using i-soln has shown exceptional sensitivity for membrane proteomics with limited material .

  • Lipidomics screening: Given YngB's role in glycolipid production, comprehensive lipidomic analysis may reveal YngA's impact on membrane composition under anaerobic conditions .

  • Transposon sequencing (Tn-seq): This approach can identify genes that become essential or beneficial specifically in a ΔyngA background, providing functional insights.

How might understanding YngA function contribute to biotechnological applications of B. subtilis?

Understanding YngA could enhance B. subtilis applications in several ways:

  • Improved recombinant protein production: B. subtilis is increasingly used as a microbial host for recombinant protein production due to its faster growth rates (doubling time as short as 20 minutes) and shorter fermentation cycles (~48 hours versus ~180 hours for yeast) . If YngA influences membrane properties or secretion, its manipulation could enhance protein yield and quality.

  • Enhanced probiotic applications: B. subtilis-based probiotics have shown efficacy in reducing gas-related gastrointestinal symptoms . If YngA is involved in membrane adaptation under anaerobic gut conditions, it might be relevant to probiotic function.

  • Novel antimicrobial targets: As an uncharacterized membrane protein potentially involved in cell wall modification, YngA might represent a novel target for antimicrobial development against pathogenic Bacillus species.

  • Genetic engineering tools: Understanding YngA function could contribute to the development of improved conditional expression systems for B. subtilis, particularly for anaerobic applications.

What considerations should guide experimental design when studying potential interactions between YngA and cell wall components?

When investigating YngA-cell wall interactions:

  • Microscopy techniques: Employ fluorescence microscopy with specific dyes (ConA for glucose residues) to visualize potential changes in cell wall composition in ΔyngA mutants, similar to approaches used for YngB characterization .

  • Cell wall fraction analysis: Use specialized extraction protocols to isolate wall teichoic acids and analyze glycosylation patterns in wild-type versus ΔyngA strains.

  • Enzymatic sensitivity assays: Test sensitivity to cell wall hydrolases like lysozyme, which can reveal alterations in cell wall properties.

  • In vitro reconstitution: Purify YngA and test direct interactions with isolated cell wall components using biophysical methods such as surface plasmon resonance.

  • Conditional depletion: Rather than gene deletion, use inducible systems to rapidly deplete YngA and observe immediate effects on cell wall synthesis before compensatory mechanisms activate.

How can researchers address the challenges of reproducing anaerobic conditions when studying YngA across different laboratories?

To ensure reproducible anaerobic research on YngA:

  • Standardized protocols: Develop detailed SOPs for anaerobic cultivation, including specific media compositions, gas mixtures, and indicators for oxygen levels.

  • Physiological markers: Monitor expression of known anaerobically-induced genes (like yngB) as internal controls to confirm true anaerobic conditions .

  • Equipment calibration: Ensure anaerobic chambers are regularly calibrated and validated using chemical and biological indicators.

  • Strain sharing: Establish a repository of key strains (wild-type, ΔyngA, complemented strains) that can be distributed between laboratories to minimize strain-specific variations.

  • Metadata reporting: When publishing, include comprehensive metadata about anaerobic conditions, including redox potential measurements, to facilitate replication.

What are the optimal conditions for purifying recombinant YngA while maintaining its native conformation?

For native-like purification of YngA:

Table 2: Optimization Parameters for YngA Purification

ParameterRecommended ConditionRationale
Expression systemB. subtilis BINGO platformMaintains proper membrane insertion and post-translational modifications
Detergentn-Dodecyl-β-D-maltopyranoside (DDM) at 1%Effectively solubilizes without denaturing
Buffer composition50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerolStabilizes membrane proteins
Reducing agent2 mM TCEPMore stable than DTT for anaerobic proteins
Purification methodIMAC followed by size exclusionTwo-step purification improves purity
TemperatureAll steps at 4°CReduces degradation
StorageAdd 40% glycerol, flash freeze, store at -80°CPreserves activity during storage

Additionally, consider incorporating native lipid extracts from B. subtilis membranes during purification to maintain a native-like lipid environment.

How can researchers differentiate between direct and indirect effects when phenotyping yngA deletion mutants?

To distinguish direct versus indirect effects in ΔyngA phenotyping:

  • Time-course experiments: Monitor phenotypes immediately after YngA depletion (using inducible systems) versus long-term adaptation in deletion mutants.

  • Complementation controls: Include both wild-type YngA and site-directed mutants affecting specific domains to identify critical functional regions.

  • Transcriptomic profiling: Compare immediate versus long-term gene expression changes following YngA deletion to identify compensatory mechanisms.

  • Conditional essentiality testing: Determine if ΔyngA phenotypes are exacerbated under specific conditions (anaerobic, cell wall stress) to identify functional contexts.

  • Suppressor screens: Identify second-site mutations that suppress ΔyngA phenotypes, which often reveal functional pathways.

  • Biochemical validation: After identifying candidate pathways from genetic screens, perform biochemical assays to test direct involvement of YngA in these processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.