Recombinant Bacillus subtilis Uncharacterized membrane protein yocA (yocA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Uncharacterized Membrane Protein YocA

The Bacillus subtilis genome encodes a multitude of proteins, many of which remain functionally uncharacterized. Among these is a membrane protein designated YocA, also known as uncharacterized membrane protein yocA . Due to its unknown function, research has been conducted to elucidate its role within the bacterium. Recombinant YocA is produced using genetic engineering techniques, where the yocA gene is inserted into a vector and expressed in a host organism, allowing for the production and purification of the protein for research purposes .

Characteristics of YocA

  • General Information Recombinant Bacillus subtilis YocA is a recombinant protein of approximately 50 ug in size, though other sizes can be made available upon request .

  • Source and Expression YocA originates from Bacillus subtilis strain 168 and encompasses the full-length protein, corresponding to amino acids 1-225 of the protein .

  • Sequence Information The amino acid sequence of YocA is:
    MKKKRKGCFAAAGFMMIFVFVIASFLLVLLFFNRDLIKKLPIDTKTIVLERLTDYKPLVEEELESQGLSNYTSLILGMMYQESKGKGNDPMQSSESLGLKRNEITDPQLSVKQGIKQFTLMYKTGKEKGVDLDTIIQSYNMGAGYIDFVAEHGGTHTEELAKQYSEQQVKKNPDLYTCGGNAKNFRYPYCYGDYTYAEKVKEKTKTVEESLQVATLETMESKAHE.

  • Gene and Protein Names The recommended protein name is Uncharacterized membrane protein yocA. The gene name is yocA, with the ordered locus names BSU19130 .

  • Storage and Handling Recombinant YocA is stored in a Tris-based buffer with 50% glycerol to maintain stability. It is recommended to store the protein at -20°C for extended storage, with the option of conserving it at -80°C. Repeated freezing and thawing cycles should be avoided; working aliquots can be stored at 4°C for up to one week .

Research Findings and Functional Analysis

While YocA is annotated as an uncharacterized membrane protein, research has provided some insights into its potential function and importance within Bacillus subtilis.

  • Essentiality Studies Systematic inactivation of Bacillus subtilis genes has identified 271 genes that are indispensable for growth . Studies examining the effects of protein depletion and subcellular localization have been conducted to elucidate the functions of these proteins. YocA is among these proteins, suggesting it may have an essential role in Bacillus subtilis .

  • Homology and Bioinformatics Bioinformatics tools and analysis of its amino acid sequence can provide clues about its potential function. The presence of transmembrane domains suggests it interacts with the cell membrane. Further research is needed to determine its specific function, such as transport of molecules, signal transduction, or maintaining membrane integrity.

Potential Applications

  • Biotechnology As more information comes to light regarding the function of YocA, there could be opportunities for its use in biotechnology. For example, if YocA is found to be involved in the transport of certain molecules, it could be exploited for drug delivery systems or bioremediation processes.

  • Medical Research Should YocA prove to be essential for survival or virulence of Bacillus subtilis, it could become a target for novel antibacterial agents.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yocA; BSU19130; Uncharacterized membrane protein YocA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yocA
Target Protein Sequence
MKKKRKGCFAAAGFMMIFVFVIASFLLVLLFFNRDLIKKLPIDTKTIVLERLTDYKPLVE EELESQGLSNYTSLILGMMYQESKGKGNDPMQSSESLGLKRNEITDPQLSVKQGIKQFTL MYKTGKEKGVDLDTIIQSYNMGAGYIDFVAEHGGTHTEELAKQYSEQQVKKNPDLYTCGG NAKNFRYPYCYGDYTYAEKVKEKTKTVEESLQVATLETMESKAHE
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is known about the uncharacterized membrane protein YocA in Bacillus subtilis?

YocA is classified as an uncharacterized membrane protein in Bacillus subtilis, similar to many proteins that remain functionally unannotated despite genome sequencing. While the human and mouse genomes contain approximately 20,000 protein-coding genes, not all are fully identified, annotated, and characterized in terms of their expression and biological function . For YocA specifically, experimental characterization remains limited, making it a candidate for functional genomics approaches similar to those used for other uncharacterized proteins.

What expression systems are most suitable for recombinant production of YocA in B. subtilis?

For expressing uncharacterized membrane proteins like YocA, B. subtilis offers several advantages as a recombinant host. Recent advances have generated expression systems with efficient promoters and economically viable chemical inducers . When selecting an expression system, researchers should consider:

  • Synthetic promoters with proven strength in B. subtilis

  • Induction mechanisms compatible with membrane protein expression

  • Signal peptides optimized for membrane protein targeting

The use of synthetic promoters has become an important alternative to natural promoters, which are often not universally characterized due to their poor performance . For membrane proteins specifically, promoters that allow moderate expression are often preferable to prevent membrane stress.

What bioinformatic approaches can predict YocA function before experimental validation?

Initial characterization of uncharacterized proteins like YocA should begin with comprehensive bioinformatic analysis:

  • Sequence similarity searches against characterized proteins

  • Domain prediction to identify functional motifs (e.g., looking for domains similar to DUF4619 found in other uncharacterized proteins)

  • Prediction of post-translational modifications like N-myristoylation and phosphorylation sites

  • Evolutionary analysis across species to identify conserved regions

  • Structural prediction to inform potential binding sites or functional regions

How can I design a knockout strain to study YocA function in B. subtilis?

Designing an effective knockout strain requires careful planning:

  • Gene targeting strategy: Design primers to amplify the yocA gene for subsequent cloning into an integration plasmid (similar to the approach used for ydjL gene characterization)

  • Selection marker: Incorporate an antibiotic resistance marker (such as chloramphenicol resistance cat gene) for selection of successful transformants

  • Verification methods:

    • PCR verification of the insertion

    • Sequencing confirmation

    • Phenotypic assays relevant to suspected function

    • Protein detection methods to confirm absence of YocA

The knockout strain should be compared with wild-type B. subtilis under various growth conditions to identify phenotypic differences. For example, when characterizing the ydjL gene, researchers observed clear differences in metabolite production (specifically 2,3-butanediol) between wild-type and knockout strains .

What protein localization techniques are most effective for confirming YocA membrane localization?

For membrane protein localization, multiple complementary approaches should be employed:

  • Fluorescence microscopy using YocA-fluorescent protein fusions (e.g., YocA-EGFP)

  • Immunohistochemistry with specific antibodies against YocA

  • Subcellular fractionation followed by Western blot analysis

  • Live-cell imaging to observe dynamics of membrane localization

When developing antibodies, ensure specificity by testing against knockout strains as negative controls. This approach was validated in FAME protein studies, where researchers "ensured that our antibody is functional and specific via detecting FAME as a part of FAME-EGFP fusion in cultured cells that do not produce FAME endogenously" .

How can proximity-dependent biotin identification (BioID) be applied to identify YocA protein interaction partners?

BioID represents an advanced approach for identifying protein interaction networks:

  • Create a fusion protein between YocA and a biotin ligase (BirA*)

  • Express the fusion protein in B. subtilis cells

  • The biotin ligase will biotinylate proteins in close proximity to YocA

  • Lyse cells and pull down biotinylated proteins using streptavidin

  • Identify interacting proteins by mass spectrometry

This approach has proven effective for other uncharacterized proteins, where "a proximity-dependent biotin identification (Bio-ID) experiment together with classical immunoprecipitation followed by mass spectrometry" revealed functional associations . For YocA, results could be visualized using STRING analysis to reveal potential functional associations with cellular processes.

What comparative metabolomic approaches would help identify the role of YocA in B. subtilis metabolism?

A comprehensive metabolomic strategy should include:

  • Cultivation conditions:

    • Compare wild-type and yocA knockout strains

    • Test multiple growth conditions (aerobic, microaerobic, anaerobic)

    • Analyze different growth phases (lag, log, early stationary, late stationary)

  • Analytical methods:

    • HPLC analysis of culture supernatants

    • Gas chromatography-mass spectrometry (GC-MS) for volatile metabolites

    • Liquid chromatography-mass spectrometry (LC-MS) for comprehensive metabolite profiling

  • Data analysis:

    • Principal component analysis to identify major differences

    • Pathway enrichment analysis to identify affected metabolic pathways

    • Time-course analysis to detect temporal changes

This approach parallels the methods used to characterize ydjL gene function, where researchers monitored multiple metabolites (acetoin, 2,3-butanediol, acetate, and lactate) at different time points to establish the gene's role in metabolism .

How can I optimize promoter selection for controlled expression of YocA in B. subtilis?

Promoter optimization should follow a systematic approach:

Promoter TypeAdvantagesDisadvantagesBest Applications
Strong constitutive (P43)High expression levelsPotential toxicity for membrane proteinsInitial detection studies
Inducible (PxylA)Controlled expressionRequires inducer additionDose-response studies
Synthetic promotersCustomizable strengthRequires characterizationFine-tuned expression
Auto-inducibleNo inducer neededLess control over timingScale-up applications

For synthetic promoter screening, consider applying the SETarSCoP strategy (promoter center spacing sequence), which has successfully generated mutant promoters that overexpress heterologous proteins in B. subtilis . This approach could be particularly valuable for membrane proteins like YocA where expression level control is critical.

What strategies can overcome challenges in expressing membrane proteins like YocA in B. subtilis?

Membrane protein expression faces specific challenges requiring specialized approaches:

  • Codon optimization: Adjust codon usage to improve translation efficiency while maintaining appropriate translation rate for proper membrane insertion

  • Signal sequence optimization:

    • Test multiple signal peptides to identify optimal membrane targeting

    • Consider creating a library of signal sequence variants

  • Cultivation conditions:

    • Lower cultivation temperature (25-30°C) to slow protein synthesis

    • Optimize media composition to support membrane protein folding

    • Consider membrane-stabilizing additives

  • Co-expression with chaperones:

    • Identify B. subtilis chaperones that may assist membrane protein folding

    • Test co-expression of these chaperones with YocA

  • Fusion partners:

    • Test N-terminal or C-terminal fusion partners known to enhance membrane protein solubility

    • Consider removable fusion tags via protease cleavage sites

These strategies address the common challenges in membrane protein expression while leveraging the "laboratory safety and excellent yields" that make B. subtilis an attractive recombinant protein production host .

How can transcriptomic and proteomic approaches help understand the physiological role of YocA?

Integrated -omics approaches provide comprehensive insights into YocA function:

  • Transcriptomics:

    • RNA-Seq comparing wild-type and yocA knockout strains

    • Differential expression analysis to identify affected pathways

    • Time-course analysis during different growth phases

    • Correlation of yocA expression with other genes to identify potential functional relationships

  • Proteomics:

    • Quantitative proteomics comparing wild-type and knockout strains

    • Analysis of membrane protein fractions to identify co-regulated membrane proteins

    • Post-translational modification analysis to identify regulatory mechanisms

    • Protein complex analysis to identify interaction partners

This integrated approach has proven valuable for characterizing other uncharacterized proteins, revealing connections to "catalytic complex, intracellular protein transport, mitochondrial inner membrane, respiratory electron transport, and protein export" .

What in vitro assays are appropriate for characterizing the biochemical function of purified YocA protein?

A systematic biochemical characterization workflow should include:

  • Protein purification optimization:

    • Detergent screening for optimal solubilization

    • Purification tag selection and positioning

    • Buffer optimization for stability

  • Functional assays based on bioinformatic predictions:

    • If transport function is predicted: liposome reconstitution and transport assays

    • If enzymatic function is predicted: substrate screening with appropriate detection methods

    • If structural role is predicted: lipid binding and membrane organization assays

  • Biophysical characterization:

    • Circular dichroism to assess secondary structure

    • Thermal stability assays

    • Size exclusion chromatography to determine oligomeric state

These approaches parallel the rigorous biochemical characterization performed for other B. subtilis proteins, where definitive function was established through careful in vitro assays measuring specific activities .

How can I ensure my functional assignments for YocA are reliable and not artifacts?

Establishing reliable functional assignments requires multiple lines of evidence:

  • Independent confirmation methods:

    • Use complementary techniques to verify key findings

    • Perform genetic complementation to confirm phenotypes are specifically due to yocA disruption

    • Create point mutations in conserved residues to verify functional importance

  • Controls and validations:

    • Include positive and negative controls in all experiments

    • Verify antibody specificity against knockout strains

    • Perform dose-response relationships where applicable

  • Statistical analysis:

    • Ensure appropriate sample sizes for statistical power

    • Use appropriate statistical tests for data analysis

    • Report effect sizes alongside statistical significance

This multi-faceted approach aligns with best practices demonstrated in characterization studies of other B. subtilis genes, where researchers emphasized that "observations reported here underscore the importance of performing wet laboratory experiments to confirm the identities of putative genes rather than relying solely upon modeling and automated annotation programs" .

What are the key considerations for publishing research on uncharacterized proteins like YocA?

Publication of research on uncharacterized proteins requires particular attention to:

  • Experimental evidence requirements:

    • Multiple independent lines of evidence supporting functional assignments

    • Clear distinction between hypotheses and experimentally verified functions

    • Appropriate controls demonstrating specificity of observed effects

  • Nomenclature considerations:

    • Recommendations for gene/protein renaming if function is definitively established

    • Clear justification for proposed nomenclature changes

    • Consistency with existing naming conventions

  • Data sharing:

    • Deposition of sequence data in appropriate databases

    • Sharing of protocols for specialized techniques

    • Provision of reagents (plasmids, strains) to the research community

These considerations reflect the experience from similar studies, such as the recommendation that "the ydjL gene be renamed bdhA" after conclusive functional characterization , ensuring that research on uncharacterized proteins contributes meaningfully to the scientific literature.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.